Identifiers and Description

Gene Model Identifier

TTHERM_01002770

Standard Name

None

Aliases

PreTt17197 | 191.m00057 | 3761.m00249

Description

Zinc finger, C2H2 type family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01002770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19844.19.997093137033517e-262zinc finger, C2H2 type family
protein (744 aa)
DictyBaseDDB_G02913425.998186291993296e-23tacA on chromosome: 6 position
140829 to 143261
SGDYOR113W9.995317835403734e-19AZF1 Zinc-finger transcription
factor, involved in induction
of CLN3 transcription in resp
onse to glucose; genetic and p
hysical interactions indicate
a possible role in mitochondri
al transcription or genome mai
ntenance
OxytrichaContig15089.0.g932.000769134519826e-18Zinc-finger double domain
WormBaseWBGene000218462.999758165421992e-18locus:ztf-23 status:Confirme
d UniProt:Q9N3C6 protein_i
d:CCD72994.1
Stentor CoeruleusSteCoe_307880.000000002061153622438558

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01002770(coding)
ATGTCTGATTACAGTAAAACCTCTTAATTTAAGGCTCCTAATGGCTAAAATGAAAATTTC
GAGTGTTAGGAATGTAATAAAACCTTTAAATATGAATCTCATTTCTTGCGTCATATTCAA
ACCCACTCAGACTCTCGTCCTTTCGAGTGTCCAAAATGCTAAAAAAAGTTTAAACGTTAA
GATGCTCTCAAAACTCATGAGCGTACTCACTCTGATGATCTTCCTTTTAAATGTTCTCGC
GAAGGATGCTGCGAAAGCTTTGCAAGCAAGGCTGCTTTGCGCTACCATGAATTACGTCAT
ACTAATGAGACTGTATTCATTTGCGATAAAGATGGGTGCAACAAGAAATTTTTGACTCTT
GGCTAACTAAAATAACATTAGCGCACAAAAATTCATGCAAAGCAAGCATGTCCTTAAGTA
TTCGGAGACTTTGATTAGTACAATAAAGCTCAACCTGCTCAAAATCTCTCTCACTCCCTC
AGCAGTAGCGGAAATATTAATAATAATTCAACTAATTCTGGATACTAAAATCAAATTTTT
TATAACCCAGCTGCACCTTATATTTAATTTTCTCAACCTCAACAATTATACAGTCTATAA
AACTCAACTTAACCTAATTTCTTGTGTGGAAATAATGTCAATTTAATTTAGAGTATGAGC
GATTACCTTTCCAATGAAAACATTCCTTAAGTGAGCAGTGTTCCCTCCAACTCTGCTCCC
AGCATTTCTACCCTTGAATAAAAAATTAACATAAAGAAGGAGCATCACTAAGAGGACACC
TTCCTAGACGATTTTAGTGAGGATGAATAAGTGTTTATCGATCAAATATGGAGTACAATT
AAACAGGAAAATACTAATAATGATTATGAATGTCCTAAAAAATCCTCTAATGAATTCAAT
AATTCTTGCGATAATGCTTACCACAGTGATTATCCAATCCAAAAACGTCGTAGAAACAAC
CCAGTAAAAAGTGATAACAAAATTAATGCTAGCTCTAACACTTCTAATCTGCTTATGGAA
TTCACTGGTCTTAATGCATCTGGAAGCTCTTTCAGTCGTCTTAAATAAGAGCTGCGTATT
ATTGTGGGACTAATTGATAAAATTAAAAAGGAAGATGAAGAATTAATACCCCCAGCTTCA
AACAGCGAAAATTAAAACTTCATTGATAATTTCGATTCCAATCAATAAGAATAATAAATC
AGTAAAAACTCTGAAAAAAGATTAAACAGCTGTGAATTTTAGAAAAATTCCACTGATTAC
CAAGAAGATTCCAATTATCACTTCTATTAAAATGATGACAGTCCCTTCCACAACTACGAA
TGTCAAATGATTCACAACAATATTCCTAGTGAAGTAATTGATAAGGATGAAAAGGAATAA
TCCAATGGATATTACAAAACCTACGAACGCCCACTATTAAAAAAGAAGATCAAAACTGCT
GTCCGTTTCGTCCAATATTGCAAGAAGGTCTTCAAGGAGCAAAAGAAGCAATAAATTTAA
CAAGATTAATAACAATAATAATAAAAGCGCATGCAAATTCAAACCACTCAAAACTCCTAT
ACTAACAAACCTTTAAACAACTACTTTGAGCAGAACGTTTAATTTAGTTTTACTCCCAAA
TAAGAGTTCTAGTAATTCTCACAATAGTATGATACTAATTCTTAATTTAGCTAACAAAAC
ACCTATAACAATTACTAAAATTTCTAAAACTTCAACGTTGAAGACTTATATCCTAAGTAA
GTTCAAATGGCAAACAACATAAACTTCGCTTCCTCTAACAGAATTAACCAACGTAACTCT
TCTTTCAATTTCACTCAATAGTCTTTCTTGCAGAATGGTTAGTAAACATAAAATAACTTC
ATGAATTAATTCAATAATAACTTCTAGAAAAACATAACCGCAAATTACTCTTTAGACCAA
TACAGAGTTCAATCTTAGTAATAACCTTCTGCTAGTTACAATGATATGGCTCCTATCTAC
ATAAGCAGCTTAAATAATACTTTGGCTGATGATAGCTAATTACAGTTCAGTGATATCGAT
ATTAATTAATTTAGTGAAATGGCTCCTAATATATTCGATGCTGCTGATGAAGTTCAAAGC
GTTTAACTCTATACTGATCACTAATTCATCCCTACTTAATAATTTAATGTCTGCAACTGA


>TTHERM_01002770(protein)
MSDYSKTSQFKAPNGQNENFECQECNKTFKYESHFLRHIQTHSDSRPFECPKCQKKFKRQ
DALKTHERTHSDDLPFKCSREGCCESFASKAALRYHELRHTNETVFICDKDGCNKKFLTL
GQLKQHQRTKIHAKQACPQVFGDFDQYNKAQPAQNLSHSLSSSGNINNNSTNSGYQNQIF
YNPAAPYIQFSQPQQLYSLQNSTQPNFLCGNNVNLIQSMSDYLSNENIPQVSSVPSNSAP
SISTLEQKINIKKEHHQEDTFLDDFSEDEQVFIDQIWSTIKQENTNNDYECPKKSSNEFN
NSCDNAYHSDYPIQKRRRNNPVKSDNKINASSNTSNLLMEFTGLNASGSSFSRLKQELRI
IVGLIDKIKKEDEELIPPASNSENQNFIDNFDSNQQEQQISKNSEKRLNSCEFQKNSTDY
QEDSNYHFYQNDDSPFHNYECQMIHNNIPSEVIDKDEKEQSNGYYKTYERPLLKKKIKTA
VRFVQYCKKVFKEQKKQQIQQDQQQQQQKRMQIQTTQNSYTNKPLNNYFEQNVQFSFTPK
QEFQQFSQQYDTNSQFSQQNTYNNYQNFQNFNVEDLYPKQVQMANNINFASSNRINQRNS
SFNFTQQSFLQNGQQTQNNFMNQFNNNFQKNITANYSLDQYRVQSQQQPSASYNDMAPIY
ISSLNNTLADDSQLQFSDIDINQFSEMAPNIFDAADEVQSVQLYTDHQFIPTQQFNVCN


>TTHERM_01002770(gene)
ATGTCTGATTACAGTAAAACCTCTTAATTTAAGGCTCCTAATGGCTAAAATGAAAATTTC
GAGTGTTAGGAATGTAATAAAACCTTTAAATATGAATCTCATTTCTTGCGTCATATTCAA
ACCCACTCAGACTCTCGTCCTTTCGAGTGTCCAAAATGCTAAAAAAAGTTTAAACGTTAA
GATGCTCTCAAAACTCATGAGCGTACTCACTCTGATGATCTTCCTTTTAAATGTTCTCGC
GAAGGATGCTGCGAAAGCTTTGCAAGCAAGGCTGCTTTGCGCTACCATGAATTACGTCAT
ACTAATGAGACTGTATTCATTTGCGATAAAGATGGGTGCAACAAGAAATTTTTGACTCTT
GGCTAACTAAAATAACATTAGCGCACAAAAATTCATGCAAAGCAAGCATGTCCTTAAGTA
TTCGGAGACTTTGATTAGTACAATAAAGCTCAACCTGCTCAAAATCTCTCTCACTCCCTC
AGCAGTAGCGGAAATATTAATAATAATTCAACTAATTCTGGATACTAAAATCAAATTTTT
TATAACCCAGCTGCACCTTATATTTAATTTTCTCAACCTCAACAATTATACAGTCTATAA
AACTCAACTTAACCTAATTTCTTGTGTGGAAATAATGTCAATTTAATTTAGAGTATGAGC
GATTACCTTTCCAATGAAAACATTCCTTAAGTGAGCAGTGTTCCCTCCAACTCTGCTCCC
AGCATTTCTACCCTTGAATAAAAAATTAACATAAAGAAGGAGCATCACTAAGAGGACACC
TTCCTAGACGATTTTAGTGAGGATGAATAAGTGTTTATCGATCAAATATGGAGTACAATT
AAACAGGAAAATACTAATAATGATTATGAATGTCCTAAAAAATCCTCTAATGAATTCAAT
AATTCTTGCGATAATGCTTACCACAGTGATTATCCAATCCAAAAACGTCGTAGAAACAAC
CCAGTAAAAAGTGATAACAAAATTAATGCTAGCTCTAACACTTCTAATCTGCTTATGGAA
TTCACTGGTCTTAATGCATCTGGAAGCTCTTTCAGTCGTCTTAAATAAGAGCTGCGTATT
ATTGTGGGACTAATTGATAAAATTAAAAAGGAAGATGAAGAATTAATACCCCCAGCTTCA
AACAGCGAAAATTAAAACTTCATTGATAATTTCGATTCCAATCAATAAGAATAATAAATC
AGTAAAAACTCTGAAAAAAGATTAAACAGCTGTGAATTTTAGAAAAATTCCACTGATTAC
CAAGAAGATTCCAATTATCACTTCTATTAAAATGATGACAGTCCCTTCCACAACTACGAA
TGTCAAATGATTCACAACAATATTCCTAGTGAAGTAATTGATAAGGATGAAAAGGAATAA
TCCAATGGATATTACAAAACCTACGAACGCCCACTATTAAAAAAGAAGATCAAAACTGCT
GTCCGTTTCGTCCAATATTGCAAGAAGGTCTTCAAGGAGCAAAAGAAGCAATAAATTTAA
CAAGATTAATAACAATAATAATAAAAGCGCATGCAAATTCAAACCACTCAAAACTCCTAT
ACTAACAAACCTTTAAACAACTACTTTGAGCAGAACGTTTAATTTAGTTTTACTCCCAAA
TAAGAGTTCTAGTAATTCTCACAATAGTATGATACTAATTCTTAATTTAGCTAACAAAAC
ACCTATAACAATTACTAAAATTTCTAAAACTTCAACGTTGAAGACTTATATCCTAAGTAA
GTTCAAATGGCAAACAACATAAACTTCGCTTCCTCTAACAGAATTAACCAACGTAACTCT
TCTTTCAATTTCACTCAATAGTCTTTCTTGCAGAATGGTTAGTAAACATAAAATAACTTC
ATGAATTAATTCAATAATAACTTCTAGAAAAACATAACCGCAAATTACTCTTTAGACCAA
TACAGAGTTCAATCTTAGTAATAACCTTCTGCTAGTTACAATGATATGGCTCCTATCTAC
ATAAGCAGCTTAAATAATACTTTGGCTGATGATAGCTAATTACAGTTCAGTGATATCGAT
ATTAATTAATTTAGTGAAATGGCTCCTAATATATTCGATGCTGCTGATGAAGTTCAAAGC
GTTTAACTCTATACTGATCACTAATTCATCCCTACTTAATAATTTAATGTCTGCAACTGA