Identifiers and Description

Gene Model Identifier

TTHERM_00994080

Standard Name

SEP1 (SEPtin 1)

Aliases

PreTt20004 | 187.m00041

Description

Septin 1, Cell division protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00735 ) Cell division protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00994080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05576.19.997093137033517e-262cell division protein (521 aa)
WormBaseWBGene000067934.9981275274605926e-36locus:unc-59 status:Confirme
d UniProt:Q9U334 protein_i
d:CAB63329.1
OxytrichaContig4578.0.g73.000842737734004e-34Septin
SGDYGR059W3.998693556225637e-29SPR3 Sporulation-specific homo
log of the yeast CDC3/10/11/12
family of bud neck microfilam
ent genes; septin protein invo
lved in sporulation; regulated
by ABFI
Stentor CoeruleusSteCoe_272783.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18586950: Wloga D, Strzyzewska-Jówko I, Gaertig J, Jerka-Dziadosz M (2008) Septins stabilize mitochondria in Tetrahymena thermophila. Eukaryotic cell 7(8):1373-86

Sequences

>TTHERM_00994080(coding)
ATGAAAGGTAATAAAAATATTTAGGAGAACAATAGATGTGATATGAATAGCTACGGAGAC
CATAAAAAGAAGAAATCAGATGTTTAATAGTAAGCTTCTAAAATATCTAAAAGTTTTGAT
CAAGCCTCCAGTGAAGCAGAAAATAATAATGCCAATGATGATGATAGCTTTTATGATTGG
AATAAGAATGGAAATTTAGAAAAAACAAACATTGATAGAGTTAAAAGTGATATCCCATAA
ACTAGGATGATACACGCTTAAATTGAAAATGAAGAAGAAGGAGAAGAAACAAAAACTCCT
GAAGATGAAGATAAATAAAGAAATAAAATGTTTCAACAATATGAAATGAGAAAAGAGGAA
CCTTCTCTTGTGTCAGAGTATGTTGTGGGCAGCTCCCCTAAAGATGAATCATCATCTGAA
TAAAGTATTGAAGAAAAAATAAAAGAAGCATCAAGTCAACATGAAAGAAATATCAGAAAT
GTGAATTTGGAAGTGAACAATAATTAGAATCTAAACATAAATTAAAATATAGAGTCTTCA
AAATACATATATTCTTCTGAAATCTAAGCTCATATTAGAATGAAAGAATAAGAACTAAAA
AAGACAATAAGTCTAAATATAATTGTCATAGGCAAAACTGGAATAGGAAAATCGACCTTT
ATAGAAGCTTTTTTAAATGAGAAATTCGAAAAATTAAATAATGAAATACGACCAACCACT
ATTGATATAATAGAGAAAAAGGCAGTGAGAAAAGAAAATGGAATAACTTTGAATTTAAAT
ATGATTGATACTCCTGGATATGATGCAGATACATAAATAGCTTAGTGGCAGCAAAAAATA
ATTGGATATATTACTTCAAAATTCGAAAAATTCAAACAAGTAAAAAAAGAGTAAGATAAT
AAAGATGCGTCAAAGTAATAAGAAATCTAAGACTAAAGAGTTCATGGATGCTTATATTTT
TTGTGTGGACCTAGAATAAATAAAGTAGACCTAGATAACTTAAAAAAATTGTAAGAATAT
GTCTCTATTATTCCTATACTAGCTAGAGGTGATTCATATACTCCAGAAGAAGTGAAATAA
TATAAAAAATAGTTGAGAAATGATGCAGATCAAAATAAAATTTTTTTCTTTGATCCATAA
GAGGTCTTTTAAGATCAGCCTGAAAAGCTTAATAAACTACTTAAAAGTCCTTTTGGTTCT
GTTCCTCCGTTTTTGATTATCTCTTCTATAAAATAAATTTAAAAATCAGAAAATCAAGTA
TTTTATGGAAGGGAATACAAATGGGGAATATGTGATATAAAAAATCCTGAGCATTCGGAT
TTTATGCTTCTTTATACTTCACTTATTGGTTATTTTAGCACAAAACTCATTAAATTGGCT
GATGTTTACCAAAATAGTTATTTCAATTAAAAAAAGAAATAATAAAAAATAAAAGAAAAA
GAAAATAAAATAGAAAAAGGGATATTATTTGCTGGGTTATTTTCTGCAGCAGCAGCATAC
ATTTATACAAAATTCTAAAAAAACTGA


>TTHERM_00994080(protein)
MKGNKNIQENNRCDMNSYGDHKKKKSDVQQQASKISKSFDQASSEAENNNANDDDSFYDW
NKNGNLEKTNIDRVKSDIPQTRMIHAQIENEEEGEETKTPEDEDKQRNKMFQQYEMRKEE
PSLVSEYVVGSSPKDESSSEQSIEEKIKEASSQHERNIRNVNLEVNNNQNLNINQNIESS
KYIYSSEIQAHIRMKEQELKKTISLNIIVIGKTGIGKSTFIEAFLNEKFEKLNNEIRPTT
IDIIEKKAVRKENGITLNLNMIDTPGYDADTQIAQWQQKIIGYITSKFEKFKQVKKEQDN
KDASKQQEIQDQRVHGCLYFLCGPRINKVDLDNLKKLQEYVSIIPILARGDSYTPEEVKQ
YKKQLRNDADQNKIFFFDPQEVFQDQPEKLNKLLKSPFGSVPPFLIISSIKQIQKSENQV
FYGREYKWGICDIKNPEHSDFMLLYTSLIGYFSTKLIKLADVYQNSYFNQKKKQQKIKEK
ENKIEKGILFAGLFSAAAAYIYTKFQKN


>TTHERM_00994080(gene)
ATGAAAGGTAATAAAAATATTTAGGAGAACAATAGATGTGATATGAATAGCTACGGAGAC
CATAGTAATATAGTTAAATTTTTACAAATATTTCTTTAGTTAATCTAAGTCTTTTAAAGA
AAAGAAGAAATCAGATGTTTAATAGTAAGCTTCTAAAATATCTAAAAGTTTTGGTAATCA
TTAAGTTTATAAACCAACTTAGCTCGTTGAAATAAATCATATAAAAAATAATTATTTAAA
AATAAATTTAGATCAAGCCTCCAGTGAAGCAGAAAATAATAATGCCAATGATGATGATAG
CTTTTATGATTGGAATAAGAATGGAAATTTAGAAAAAACAAACATTGATAGAGTTAAAAG
TGATATCCCATAAACTAGGATGATACACGCTTAAATTGAAAATGAAGAAGAAGGAGAAGA
AACAAAAACTCCTGAAGATGAAGATAAATAAAGAAATAAAATGTTTCAACAATATGAAAT
GAGAAAAGAGGAACCTTCTCTTGTGTCAGAGTATGTTGTGGGCAGCTCCCCTAAAGATGA
ATCATCATCTGAATAAAGTATTGAAGAAAAAATAAAAGAAGCATCAAGTCAACATGAAAG
AAATATCAGAAATGTGAATTTGGAAGTGAACAATAATTAGAATCTAAACATAAATTAAAA
TATAGAGTCTTCAAAATACATATATTCTTCTGAAATCTAAGCTCATATTAGAATGAAAGA
ATAAGAACTAAAAAAGACAGTAAGTAAATTTGTTAAGTTGAATAAAGTTAAGCTTATAAA
ATTATAAAATAATAACGAATTCCACTCATCTATCTATATATCTATCTCACTCATTTGATA
TTATTTACTTAATTGCTTTATTCATTTCACTGATTTGAATTTTTAAAAACTAACTTTTAA
AACTAAAAGATAAGTCTAAATATAATTGTCATAGGCAAAACTGGAATAGGAAAATCGACC
TTTATAGAAGCTTTTTTAAATGAGGTAAGTGCTTTCTTTAAAGATTTGTTTCGGTATCTG
ATCATTAAATATTATTTTTAAATAGAAATTCGAAAAATTAAATAATGAAATACGACCAAC
CACTATTGATATAATAGAGAAAAAGGCAGTGAGAAAAGAAAATGGAATAACTTTGAATTT
AAATATGATTGATACTCCTGGATATGATGCAGATACATAAATAGCTTAGTGGCAGCAAAA
AATAATTGGATATATTACTTCAAAAGTAATTTCTTATGTTAAAATTTCTTGATTAAATTT
ATATTTTATTTTAAAAGTTCGAAAAATTCAAACAAGTAAAAAAAGAGTAAGATAATAAAG
ATGCGTCAAAGTAATAAGAAATCTAAGACTAAAGAGTAATTTATATGATTGTATTTTTAA
AATATTTTAAATCTGATTCTTTTAAAATTATTTAATTTAAATTTTTTATTATTATGATTC
ATTTATCTGCATTCCTTAGTGTTCTTATCTTTTCATTTAATTTTTTAGTCATATCATAGT
CACTATTACTATTGATTGTGAACATTTTTATATTTATGTTCTATTTATTCAGAAGTTAAT
TTTATAAAGAATAAATCATTTGATTGAAAAACTTTAGCTGATATAACATACATTTATGAA
TGGATAAAAATACAAATTTAGTTATTGATTTATCTTACCAATAATAAAGGTTCATGGATG
CTTATATTTTTTGTGTGGACCTAGAATAAATAAAGTAGACCTAGATAACTTAAAAAAATT
GTAAGAATATGTCTCTATTATTCCTATACTAGCTAGAGGTGATTCATATACTCCAGAAGA
AGTGAAATAATATAAAAAATAGTTGAGAAATGATGCAGATCAAAATAAAATTTTTTTCTT
TGATCCATAAGAGGTATGCATTCATGCATCAATGCTTTATCTTTAATAAAAAATATAATA
TTTTATATTTATAAAATTATTTAGGTCTTTTAAGATCAGCCTGAAAAGCTTAATAAACTA
CTTAAAAGTCCTTTTGGTTCTGTTCCTCCGTTTTTGATTATCTCTTCTATAAAATAAATT
TAAAAATCAGAAAATCAAGTATTTTATGGAAGGTATATGGTTTGTTTTAAATAATTCAAT
ATATTCTTAAATTTTTTTATTTATTAAAATCAGGGAATACAAATGGGGAATATGTGATAT
AAAAAATCCTGAGCATTCGGATTTTATGCTTCTTTATACTTCACTTATTGGTTATTTTAG
CACAAAACTCATTAAATTGGCTGATGTTTACCAAAATAGTTATTTCAATTAAAAAAAGAA
ATAATAAAAAATAAAAGAAAAAGAAAATAAAATAGAAAAAGGGATATTATTTGCTGGGTT
ATTTTCTGCAGCAGCAGCATACATTTATACAAAATTCTAAAAAAACTGA