Identifiers and Description

Gene Model Identifier

TTHERM_00989350

Standard Name

SEP3 (SEPtin 3)

Aliases

PreTt07825 | 185.m00046

Description

Septin 3, Cell division protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF05178 ) Krr1 family
  • ( PF00646 ) F-box domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF00735 ) Cell division protein
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01784 ) conserved hypothetical protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04671 ) Erythrocyte membrane-associated giant protein antigen

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00989350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02932.19.997093137033517e-262cell division protein (1496 aa
)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18586950: Wloga D, Strzyzewska-Jówko I, Gaertig J, Jerka-Dziadosz M (2008) Septins stabilize mitochondria in Tetrahymena thermophila. Eukaryotic cell 7(8):1373-86

Sequences

>TTHERM_00989350(coding)
ATGATTTGTTATTAGGAAAAAGAAAAATAAGTTAAAGAATTCAATCAAAATCTATCTTTA
TTTTATATAGCAAGAGGGTAGCAGTAATTACAAGTACTTAAATCAATCAAACAAAAAGTA
AAATTAAGAAGAAGAATAAAAGAGGGAAAACTTAAATAAATTTTATAAAGTTTTGTTGTA
TCCGAAATCTCTGATCAGAAGCAAGTTAAACATAAAAGTATTTAGAAGGTCATAAAAGAC
GTGGTAGGTGAAATAGGAGTCATACTTAGTTAGGAAACAGTGAAGCAAAAGCTAAAATAA
GTAGAGAAATAAATGGATCAAGCAAAGCAATTTTCAGATAAAAAAAAGAAAGAAATACCA
ATTATGAAATAGAAAGAATCAATTTTGTTACAAAGGTCAAATGAAAGCATAATTTTAGAG
TAAAAGCAAAAAAATATAATATTCACTAAATTGCCAGCGAGGTTGGTCAATATTATTTTG
GAGATGCTTGATCCTAACGAAGTGCCTGTCCTCAGGTGTGTTTGTAGGTGGTTCAAAGAT
TATATAGATTCAAATGATAATTTAATAGCTATACAAGTTTTTTCTTTATTTTTTCCTAAG
CAAGTTGATTTTTTTTGTGATTATGGCGAAAACGATATATTTTTGCAAGAGCGAGCCAAA
AAGAACTATATTATCTCTCATAATACTCGAAACCAGAGTAAATGGAGGTCATTTTTGAAG
ATTTACAGGGATGTCAGAGAGAGTTTTCTTGCTGTTAACTACAAGATATTTTTATTTGGA
TAGGAGCAAAAAGAAAAGCAGTAGAACAAAGAATAAACAAATTAAAATAATTTATTAGAT
TAAAAAAATAATTTTAATGGCAACCCAAATAAAGCTGTTTCAAAGCTTGGAGGTTTAGCA
CCATTACCATTAGATAATGACCTAGACGATTCAACTGATTAAAAAGGAACTGGTTTTGAT
TTTGATCAATTTGGTTTTAATGCAAGTTCTTCCTAATAAGAAGACAGTAGTAAAAACAAA
TTTGGAGATTCTTAGTTTAAATTTAACATGTAGGATCAGGAAAGCGGAGAAAGTCAGAAT
ACAAATTAACAACAGCCTTTATTTAAATTTAAGTAATCGTAGGATTCTGATAACGTAAAC
AGTAGTTAAAATACAGAAAATTAAGATGTTTGCAGCATGGATTTTTCAAAGCATAAAATT
TAAGCATAGAAAATGTCGTAGATAACTTCAAAATATATTTGGGGAGTTCTCAAAGATCCA
CCTCTTCCTATTTTGAAATTGAGGAGAGAAAACATTGGTAATTATTGCAATACTTGGTTT
TAGAATAAGCTAGCTGAAGTTTTGTGGGAGGGATCAAGGCAAATTGGAATTGGATTACAT
AAATTCACAGAAGAGGAGCAGCCTCTCTTATCAATAAATAATATCATCCGTGATAACAAA
TAGTATTTTATTGATGAAATAAAGTAGTTTTGCGAGAAATGGCCATTCCAAAAAAATGAA
ATTTTGAATTTAAGATACTACTTCTATAAAAACAAGCCTACTTTCTCCTATGTTAGTAGA
CAAACCAAAAGAAAACTAACAGGTTCTTTTAACAAGCAAACAAGTCCTCGAATTTTATTT
ACAAAGCCGAGTAGAAATTTATCTACCATGGAAGATTAAGGATTTACAAACATATTAGGT
ACCAATAAAAGTTTCCAAAGTTAAATAAATACGAATTTAGCCACATAAAATTCCAATCCT
AATCCTGTCGTATTTAATTTCTTTGACAACAATAACAACAATAACCACAGTAACAGAGAT
AGTTTAGATCAATATTCTTCTCCAACTAAACCATAGATAGCACAACAGAATAGCTAAGGG
TAAAAAGGTCTCTTTGATAATATATTCCAATTTGCACATAAATAGCCAGATCAAGATAAT
GACTTTTTTACTGACCTAGATTTAGATAATTAAGAAGAAGAAAATAATTAGTTTTAGGAA
AATGACTACATAATGCAGATGAGATAAAAACCCTTACTTATATGCTTTATTGAGAATTTA
GTAGATTTATTTATTTTCAAGTGCTAGCTGATTTATGAGTATCTTAAGGAGCACATGAAT
GGCTAAAATGTTCATGAATCAAGCGGTATTAAGAAAAATGGGTTTGATTTACTTAGTGAG
TATAATATTAAATGGAATATCTACATAGCTTTTCTGAATGAAATAGAAGAACAATTAAAG
GATGTTTTTGAAGTATATAACGAAGCTTTTGATTAAATTTTTGAAGACTATCCCTAGCAT
CCTAGGATGAGTATTTGGCGTTTAATGGTAAAGATTTGGATTTAAGAAATATACTCCAAA
GATGAGATTAAAGAGAATCTATATGGATGCTTTTTAAAGATTCTGTCTATAAGAAGATAA
GAAAATTTCTAATTTTAAATGAAGCAAATTGAATTAGACAGAAAGGTTCAACAATAATAT
TACATGCCCGATTAACTTGAGTATATTTCGCTAACTCTTTTAAATAACTTAACTAAAAAT
AAAAATTTTTCTCTTTTGAATTATGGTGAAGGCTATGATTATTTTCATTCATTTTTCTCT
AAAAATTAATATCATGCTGATTCGTTGCTAAGTAGCTTTGTTGAGAGCACAGTCGATTTA
TCTTTGAATGAAATTTCAGTTCACTATTTAGGCCATTCTCAAGTTTAAATGGATAAACCG
TATTTAGAGTTAGAAAAGCAACTTCTTGATTCCTCTTAAATATATTTCCGCCATTAATAG
AGCATGTTCTTGTCCAATCCCAGTAATTATTTGCTCTTTTTAAAAGGAGATTTGAAATAC
GTTTCAAAAATCTTTAAGGAGAGAAGTTAAACTCTTCTTAGGAAGAAAATGCTTGAACAC
TGGAAAGAAATGTTTAAAGATATAATAGCATAAAAATTACCCAAATAATTTGAATTATTC
AATGAAAAAGATGAAAAAACAAAAAATTTAATCCAGCAACATGTAAAGTAGCAAATACAA
AGTTTAAAAATCTAATAATAGAACCAAATTTAAAGCGATAACAATTTAGCACAACCTCTA
CTGGCTCAACAAAATACACAATCTTAAGATGGCGAAGATCAGAGTTAGCAGCTTTAAGCA
AGCAATTTATCGAATTAACAAAATGAAGAGCAGCCAAATAGATAGTCTATCTTTTCAAAT
GACACTCTGCCTTCTCTAATATACTAAATTTTAGAAGAATAAGAACTTAAATAAAAATAA
CAAGAATAAATTTAAATTGAATTGAATTCCAAAACTAATTCTGTTGATACTCATTAGATA
TTGCTACAAAAAAGTAATAACAACAGCAATAGTACTAATAACAACATTTTTAATTGCTCA
AATGATTTATTTTCTATTGAAAAGAAAGGAGATTTCTTCGATTAATAAGCTTAAAGCAAT
AATTAAAGTAACTTCTTTGAGTGCAACAATAACGAAGATGATTTACCAGAGATTCCAGGT
ATTAACAATAACCCAGTAATAGAAAAGAAAGATATAAGTACTAGAAGTAACCTGACATAA
TAAAATTTAGGTTTTTCAAGTGAAGAGTTAGAAAAAATACAAGAAAAAGCTCATATTCTC
TCACACATGTTTAGGATGGGTGATGACTAAACTAAGTTGGATATTTAAAATTACATAGAA
ACATGTAAATCTTTAAATGAGATGAACACAAGTAAATCAGATTAGGATTTGGAAATCGAA
GAGCTTAATAACATGCGCCGCTTACCTATTGTTTTAAATAATGAGGAATAAACTTTTTTC
TTTTTAACTAGATCTTTGACAGAAGAAGTTCTTTAAGAGACCATTTTAAAGTAAAAAGAA
TTCCTCAGACAGCAAAGAGAATCAAATAACGATGGAGATTCTGAAGAAGATGAAGAAGAA
AATGAACATCACGAAAATCAGCATTATAGTGGAGATGAAGAAGAAGGTGATGAGCATGAG
TAAAGCAACGGTGAGCCTTAATTGAAATTCGATGATGATGAAGATGATGATTCAAACAAC
TCATTAGATGAAATACCTAATTCATTAAGCTTAAAAGGAAATAAAACCTAAAATAAACCC
AAAAAGAATAAAGCGAAATAGAAAGTGGAATAAGACATTCCTGTTTATAATTCAGGCGAT
GAGTCAGATTCGCACGTTGATGATACAACAACTGCAGGAAATATAAACTTTTTTAATGTA
AAAAAATAAGAAAGTAATGCATCTGACTTTTCTCTGGGCTTAGACAAAGAAACTTCTAGG
ATATCAAATCATTTCTTATTTAACGAAAACCTGACTTCGAACTAAAAGTAAGAACAAGAA
GATAAAATATAATTTAACTTTGATATAAATAGCACAAAACAGGAAGAAGCACAATAATAA
TAGCAACCAATGAATTTTGACTTTTTCAAATTGGAAAAGCAAAGTAGTGCTCCTGGAAAT
CAAATCAATATGTTTACATTTAAGCTTCAAAGCAATGATTAAATCAACATTAAAGCTAAT
AAAAAATCTCTAGATGACGATTAAGAGCATAACTTTTTTGCTAATTGCACTCCATCAATG
TCGTAGAACAATTAAAATAACAGCAAAAATTCTAACACCCAAATAAAAGTAGATTTATTC
TCAAATATTTCGAATAATAATAACAACAATGATAACTAGTTTACAATAAATTTTAATAAC
AATATTACTCATAAAAACAACACAACTTCTCCCTCAATAAATAGTTAAAATATGTTTTTC
AATTTGCTTAACAATATAAATAAAGATAATAATTCAGAAGAAACCAGTAGCAATAATAAT
AATGAAGAAGAAGTTAAAGATTAATCTTGA


>TTHERM_00989350(protein)
MICYQEKEKQVKEFNQNLSLFYIARGQQQLQVLKSIKQKVKLRRRIKEGKLKQILQSFVV
SEISDQKQVKHKSIQKVIKDVVGEIGVILSQETVKQKLKQVEKQMDQAKQFSDKKKKEIP
IMKQKESILLQRSNESIILEQKQKNIIFTKLPARLVNIILEMLDPNEVPVLRCVCRWFKD
YIDSNDNLIAIQVFSLFFPKQVDFFCDYGENDIFLQERAKKNYIISHNTRNQSKWRSFLK
IYRDVRESFLAVNYKIFLFGQEQKEKQQNKEQTNQNNLLDQKNNFNGNPNKAVSKLGGLA
PLPLDNDLDDSTDQKGTGFDFDQFGFNASSSQQEDSSKNKFGDSQFKFNMQDQESGESQN
TNQQQPLFKFKQSQDSDNVNSSQNTENQDVCSMDFSKHKIQAQKMSQITSKYIWGVLKDP
PLPILKLRRENIGNYCNTWFQNKLAEVLWEGSRQIGIGLHKFTEEEQPLLSINNIIRDNK
QYFIDEIKQFCEKWPFQKNEILNLRYYFYKNKPTFSYVSRQTKRKLTGSFNKQTSPRILF
TKPSRNLSTMEDQGFTNILGTNKSFQSQINTNLATQNSNPNPVVFNFFDNNNNNNHSNRD
SLDQYSSPTKPQIAQQNSQGQKGLFDNIFQFAHKQPDQDNDFFTDLDLDNQEEENNQFQE
NDYIMQMRQKPLLICFIENLVDLFIFKCQLIYEYLKEHMNGQNVHESSGIKKNGFDLLSE
YNIKWNIYIAFLNEIEEQLKDVFEVYNEAFDQIFEDYPQHPRMSIWRLMVKIWIQEIYSK
DEIKENLYGCFLKILSIRRQENFQFQMKQIELDRKVQQQYYMPDQLEYISLTLLNNLTKN
KNFSLLNYGEGYDYFHSFFSKNQYHADSLLSSFVESTVDLSLNEISVHYLGHSQVQMDKP
YLELEKQLLDSSQIYFRHQQSMFLSNPSNYLLFLKGDLKYVSKIFKERSQTLLRKKMLEH
WKEMFKDIIAQKLPKQFELFNEKDEKTKNLIQQHVKQQIQSLKIQQQNQIQSDNNLAQPL
LAQQNTQSQDGEDQSQQLQASNLSNQQNEEQPNRQSIFSNDTLPSLIYQILEEQELKQKQ
QEQIQIELNSKTNSVDTHQILLQKSNNNSNSTNNNIFNCSNDLFSIEKKGDFFDQQAQSN
NQSNFFECNNNEDDLPEIPGINNNPVIEKKDISTRSNLTQQNLGFSSEELEKIQEKAHIL
SHMFRMGDDQTKLDIQNYIETCKSLNEMNTSKSDQDLEIEELNNMRRLPIVLNNEEQTFF
FLTRSLTEEVLQETILKQKEFLRQQRESNNDGDSEEDEEENEHHENQHYSGDEEEGDEHE
QSNGEPQLKFDDDEDDDSNNSLDEIPNSLSLKGNKTQNKPKKNKAKQKVEQDIPVYNSGD
ESDSHVDDTTTAGNINFFNVKKQESNASDFSLGLDKETSRISNHFLFNENLTSNQKQEQE
DKIQFNFDINSTKQEEAQQQQQPMNFDFFKLEKQSSAPGNQINMFTFKLQSNDQINIKAN
KKSLDDDQEHNFFANCTPSMSQNNQNNSKNSNTQIKVDLFSNISNNNNNNDNQFTINFNN
NITHKNNTTSPSINSQNMFFNLLNNINKDNNSEETSSNNNNEEEVKDQS


>TTHERM_00989350(gene)
ATGATTTGTTATTAGGAAAAAGAAAAATAAGTTAAAGAATTCAATCAAAATCTATCTTTA
TTTTATATAGCAAGAGGGTAGCAGTAATTACAAGTACTTAAATCAATCAAACAAAAAGTA
AAATTAAGAAGAAGAATAAAAGAGGGAAAACTTAAATAAATTTTATAAAGTTTTGTTGTA
TCCGAAATCTCTGATCAGAAGCAAGTTAAACATAAAAGTATTTAGAAGGTCATAAAAGAC
GTGGTAGGTGAAATAGGAGTCATACTTAGTTAGGAAACAGTGAAGCAAAAGCTAAAATAA
GTAGAGAAATAAATGGATCAAGCAAAGCAATTTTCAGATAAAAAAAAGAAAGAAATACCA
ATTATGAAATAGAAAGAATCAATTTTGTTACAAAGGTCAAATGAAAGCATAATTTTAGAG
TAAAAGCAAAAAAATATAATATTCACTAAATTGCCAGCGAGGTTGGTCAATATTATTTTG
GAGATGCTTGATCCTAACGAAGTGCCTGTCCTCAGGTGTGTTTGTAGGTGGTTCAAAGAT
TATATAGATTCAAATGATAATTTAATAGCTATACAAGTTTTTTCTTTATTTTTTCCTAAG
CAAGTTGATTTTTTTTGTGATTATGGCGAAAACGATATATTTTTGCAAGAGCGAGCCAAA
AAGAACTATATTATCTCTCATAATACTCGAAACCAGAGTAAATGGAGGTCATTTTTGAAG
ATTTACAGGGATGTCAGAGAGAGTTTTCTTGCTGTTAACTACAAGATATTTTTATTTGGA
TAGGAGCAAAAAGAAAAGCAGTAGAACAAAGAATAAACAAATTAAAATAATTTATTAGAT
TAAAAAAATAATTTTAATGGCAACCCAAATAAAGCTGTTTCAAAGCTTGGAGGTTTAGCA
CCATTACCATTAGATAATGACCTAGACGATTCAACTGATTAAAAAGGAACTGGTTTTGAT
TTTGATCAATTTGGTTTTAATGCAAGTTCTTCCTAATAAGAAGACAGTAGTAAAAACAAA
TTTGGAGATTCTTAGTTTAAATTTAACATGTAGGATCAGGAAAGCGGAGAAAGTCAGAAT
ACAAATTAACAACAGCCTTTATTTAAATTTAAGTAATCGTAGGATTCTGATAACGTAAAC
AGTAGTTAAAATACAGAAAATTAAGATGTTTGCAGCATGGATTTTTCAAAGCATAAAATT
TAAGCATAGAAAATGTCGTAGATAACTTCAAAATATATTTGGGGAGTTCTCAAAGATCCA
CCTCTTCCTATTTTGAAATTGAGGAGAGAAAACATTGGTAATTATTGCAATACTTGGTTT
TAGAATAAGCTAGCTGAAGTTTTGTGGGAGGGATCAAGGCAAATTGGAATTGGATTACAT
AAATTCACAGAAGAGGAGCAGCCTCTCTTATCAATAAATAATATCATCCGTGATAACAAA
TAGTATTTTATTGATGAAATAAAGTAGTTTTGCGAGAAATGGCCATTCCAAAAAAATGAA
ATTTTGAATTTAAGATACTACTTCTATAAAAACAAGCCTACTTTCTCCTATGTTAGTAGA
CAAACCAAAAGAAAACTAACAGGTTCTTTTAACAAGCAAACAAGTCCTCGAATTTTATTT
ACAAAGCCGAGTAGAAATTTATCTACCATGGAAGATTAAGGATTTACAAACATATTAGGT
ACCAATAAAAGTTTCCAAAGTTAAATAAATACGAATTTAGCCACATAAAATTCCAATCCT
AATCCTGTCGTATTTAATTTCTTTGACAACAATAACAACAATAACCACAGTAACAGAGAT
AGTTTAGATCAATATTCTTCTCCAACTAAACCATAGATAGCACAACAGAATAGCTAAGGG
TAAAAAGGTCTCTTTGATAATATATTCCAATTTGCACATAAATAGCCAGGTTTAAAATTT
TATTTTATTTATTGAAATTATATTAAAAGCCTGAAAATATTTATAATTATTTTCTCTATA
AATAACTTAGATAATTAAACTATTTTTTTTAATAAAAAACTCTTTAGGGATTTAATTTTA
AATAATTTTTTTGAAATAAAAATTTCATTAGATTCTCTTTATTAAATGTATTTAATTGGC
ATTTAATATGATCATTTTTAATAGATTCAAAATCATTTTTAGCAGATTACTTTTTATTTT
TTAAAAATTAACTAGTTATTTTTAGTAGAAATATTTGTTTAATTGAGGTTAATTATAATA
TGATATTTTTTATTTGAAATAGATCAAGATAATGACTTTTTTACTGACCTAGATTTAGAT
AATTAAGAAGAAGAAAATAATTAGTTTTAGGAAAATGACTACATAATGCAGATGAGATAA
AAACCCTTACTTATATGCTTTATTGAGAATTTAGTAGATTTATTTATTTTCAAGTGCTAG
CTGATTTATGAGTATCTTAAGGAGCACATGAATGGCTAAAATGTTCATGAATCAAGCGGT
ATTAAGAAAAATGGGTTTGATTTACTTAGTGAGTATAATATTAAATGGAATATCTACATA
GCTTTTCTGAATGAAATAGAAGAACAATTAAAGGATGTTTTTGAAGTATATAACGAAGCT
TTTGATTAAATTTTTGAAGACTATCCCTAGCATCCTAGGATGAGTATTTGGCGTTTAATG
GTAAAGATTTGGATTTAAGAAATATACTCCAAAGATGAGATTAAAGAGAATCTATATGGA
TGCTTTTTAAAGATTCTGTCTATAAGAAGATAAGAAAATTTCTAATTTTAAATGAAGCAA
ATTGAATTAGACAGAAAGGTTCAACAATAATATTACATGCCCGATTAACTTGAGTATATT
TCGCTAACTCTTTTAAATAACTTAACTAAAAATAAAAATTTTTCTCTTTTGAATTATGGT
GAAGGCTATGATTATTTTCATTCATTTTTCTCTAAAAATTAATATCATGCTGATTCGTTG
CTAAGTAGCTTTGTTGAGAGCACAGTCGATTTATCTTTGAATGAAATTTCAGTTCACTAT
TTAGGCCATTCTCAAGTTTAAATGGATAAACCGTATTTAGAGTTAGAAAAGCAACTTCTT
GATTCCTCTTAAATATATTTCCGCCATTAATAGAGCATGTTCTTGTCCAATCCCAGTAAT
TATTTGCTCTTTTTAAAAGGAGATTTGAAATACGTTTCAAAAATCTTTAAGGAGAGAAGT
TAAACTCTTCTTAGGAAGAAAATGCTTGAACACTGGAAAGAAATGTTTAAAGATATAATA
GCATAAAAATTACCCAAATAATTTGAATTATTCAATGAAAAAGATGAAAAAACAAAAAAT
TTAATCCAGCAACATGTAAAGTAGCAAATACAAAGTTTAAAAATCTAATAATAGAACCAA
ATTTAAAGCGATAACAATTTAGCACAACCTCTACTGGCTCAACAAAATACACAATCTTAA
GATGGCGAAGATCAGAGTTAGCAGCTTTAAGCAAGCAATTTATCGAATTAACAAAATGAA
GAGCAGCCAAATAGATAGTCTATCTTTTCAAATGACACTCTGCCTTCTCTAATATACTAA
ATTTTAGAAGAATAAGAACTTAAATAAAAATAACAAGAATAAATTTAAATTGAATTGAAT
TCCAAAACTAATTCTGTTGATACTCATTAGATATTGCTACAAAAAAGTAATAACAACAGC
AATAGTACTAATAACAACATTTTTAATTGCTCAAATGATTTATTTTCTATTGAAAAGAAA
GGAGATTTCTTCGATTAATAAGCTTAAAGCAATAATTAAAGTAACTTCTTTGAGTGCAAC
AATAACGAAGATGATTTACCAGAGATTCCAGGTATTAACAATAACCCAGTAATAGAAAAG
AAAGATATAAGTACTAGAAGTAACCTGACATAATAAAATTTAGGTTTTTCAAGTGAAGAG
TTAGAAAAAATACAAGAAAAAGCTCATATTCTCTCACACATGTTTAGGATGGGTGATGAC
TAAACTAAGTTGGATATTTAAAATTACATAGAAACATGTAAATCTTTAAATGAGATGAAC
ACAAGTAAATCAGATTAGGATTTGGAAATCGAAGAGCTTAATAACATGCGCCGCTTACCT
ATTGTTTTAAATAATGAGGAATAAACTTTTTTCTTTTTAACTAGATCTTTGACAGAAGAA
GTTCTTTAAGAGACCATTTTAAAGTAAAAAGAATTCCTCAGACAGCAAAGAGAATCAAAT
AACGATGGAGATTCTGAAGAAGATGAAGAAGAAAATGAACATCACGAAAATCAGCATTAT
AGTGGAGATGAAGAAGAAGGTGATGAGCATGAGTAAAGCAACGGTGAGCCTTAATTGAAA
TTCGATGATGATGAAGATGATGATTCAAACAACTCATTAGATGAAATACCTAATTCATTA
AGCTTAAAAGGAAATAAAACCTAAAATAAACCCAAAAAGAATAAAGCGAAATAGAAAGTG
GAATAAGACATTCCTGTTTATAATTCAGGCGATGAGTCAGATTCGCACGTTGATGATACA
ACAACTGCAGGAAATATAAACTTTTTTAATGTAAAAAAATAAGAAAGTAATGCATCTGAC
TTTTCTCTGGGCTTAGACAAAGAAACTTCTAGGATATCAAATCATTTCTTATTTAACGAA
AACCTGACTTCGAACTAAAAGTAAGAACAAGAAGATAAAATATAATTTAACTTTGATATA
AATAGCACAAAACAGGAAGAAGCACAATAATAATAGCAACCAATGAATTTTGACTTTTTC
AAATTGGAAAAGCAAAGTAGTGCTCCTGGAAATCAAATCAATATGTTTACATTTAAGCTT
CAAAGCAATGATTAAATCAACATTAAAGCTAATAAAAAATCTCTAGATGACGATTAAGAG
CATAACTTTTTTGCTAATTGCACTCCATCAATGTCGTAGAACAATTAAAATAACAGCAAA
AATTCTAACACCCAAATAAAAGTAGATTTATTCTCAAATATTTCGAATAATAATAACAAC
AATGATAACTAGTTTACAATAAATTTTAATAACAATATTACTCATAAAAACAACACAACT
TCTCCCTCAATAAATAGTTAAAATATGTTTTTCAATTTGCTTAACAATATAAATAAAGAT
AATAATTCAGAAGAAACCAGTAGCAATAATAATAATGAAGAAGAAGTTAAAGATTAATCT
TGA