Identifiers and Description

Gene Model Identifier

TTHERM_00985030

Standard Name

SEMI1 (selected haploid micronucleus 1)

Aliases

PreTt23273 | 184.m00048

Description

transmembrane protein putative; Protein attaches gamete nuclei to the junction of conjugating cells

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08518 ) Spa2 homology domain (SHD) of

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.6%

TetraMine Data

TTHERM_00985030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07236.11.000371485572848e-69hypothetical protein (436 aa)

General Information

Paragraph NoGene NameParagraph Text
135SEMI1Semi1 interacts (CoIP) with Zfr3 and Ftt18 and colocalizes with Zfr3 at the periphery of the selected haploid micronucleus.

Associated Literature

  1. Ref:31884169: Akematsu T, Sánchez-Fernández R, Kosta F, Holzer E, Loidl J (2019) The Transmembrane Protein Semi1 Positions Gamete Nuclei for Reciprocal Fertilization in Tetrahymena. iScience 23(1):100749

Sequences

>TTHERM_00985030(coding)
ATGGATTTTACTTAATTGATTGGCACTTTATATTCAACAAAAAAAGAGAATATTTAATGC
TCAGGTGAATAAAATAAAAATAAATGGATTAACATGCTAAATTTACTAAATAGTTTTGAA
AATAGCTAAGCAAAATCTTTGTAAAGTCAGCAATAAAATGGCCTTTCACACTCAGATTTT
AAAAATAGTTTACTCAAAAATAGTACTTTGTAATTATTTTGTTAATGTTAAGAGCAACTT
GAATATTTAGTTAATCTTCAAATGAAATTTCAAGAAAGAGGACTTAAGCTTAGAGAGGAT
TTAAATGAATAGTAAATGCTTGAAGTAGGACTATGCTTTGCAATAATCTTGATTTTAGAG
AATGATTTTATTAGCCATGAATTTTTTGGTATTGATCAAAACAAAACATAACCTGCCTTT
AAAAGTATTCACAAAGTGTTAAACTATGATTACTTTATCGACAATAGCTCGAATGAAAAT
CTACAAAGGTATGAAGAAATTACTTACAAAACAGCTCAATCAACAAATAATTAAACAGAA
AATATTAGCACAGAGAAAAATAATGAATTGGAAAAATATTTGCAAACTGAACTAAAACAC
ACAAGTAGCTCGCCATAACTTTAATCTCAATCACCTTTAAAGATCTAAATTTAAAACAAT
TAGCATTAAAAATCATTTTCAACATAAAACTATTTCTCTTAAAATCTATACAAAAACTCG
CAAGCTAAATGCTCAACAATCTCTCAAACAAACAAAAATTAGCTAGTGAGTAAAAACTAA
AGTTAAAATGTTTTGTTTTAAGAAAATCATATTTTAAACTTAAGCATTCTTTTTTACAGA
TTTTTTAATTCTTTTTAAATGAGTTATGATACATTTTCATCATAAACTGAGTACTCTTTG
AGCAATTAATTCTAAAATGCTATTTCGGAATAATAATTTAATTTTAACTTTTGTGAAAAG
GTTTTGAGAGAAAGTTAAAAGAAAGATGAATCTAATGTCTTCTAGGAATAAAAATACATT
ACTCCAAAAAGATTAACCACACCTGATGCTATTAAATTAATAGAAAATAATTAATCAATT
ATTTCTGATAACAAAGAAAATCAAAAAGGAAATGTTCTGGAAAGTAACATTTACACTAAT
TCTTTTGAAAAGAGCGTAATTAATCAGAATTAGGATATTCTAAATTTTTTTTTTGAAGAT
CCATCAAAAAAGCTCAAAAAATCCAATAGACATTCAATGGACTGTTTGGGAGACAAAATG
AATGATTCACCAATGTAACTTAAAAACTTTCATATGAGCAAAAAGAAAGAATAGAGGTTT
GAATCATGTGTTATAAACGGAAACAATAATCTCTTTGAAGAGAGTTAACTGATAATAAAC
AAACTTGACCTACAAAAAAGGAGATATTAGCAATATTCTCAAGAGCAAAGCAAACTAATA
TAAGAACTACATAGCTTATACATCGATCTAAAAACAAAATATGAGTCTCTTCAGCAATCT
AGTTTGAATTTTTCTAATGATTAAGAAGCTAAACAAAAAGTGAGGGAAAGCCAACAAAAC
TTTAGTATTGAAAACAAATAAAAGAATATTGTAAAAAAAAGTGATTTTTAATAGATTAAT
ACTTAAAATTGTGAATTTGATAATTCATCTGTAAACGAATAAAAACAAAACTAAAAAAAT
GACGAATAAATTTTTGAAAGCAAAATAATTTAATCATCTACTTTGAGCTAGAGCAACATA
AAGACTAGTGAATGTAATCCTATGACAATGTAGCTTAACTATTAGTAAAAAAATAAGATT
TTTACTGAAAACGACTCAGATATTAATAGAAGATAAGTGCATGATGATATTTTAAGTTAG
AATTTTTTATTCTAAAGTGTAAACATAAACTAAAGCAATTGTGACTAACTTCCTTAACAA
AATAGTTTGAACCCTGAAGACTAACAATCAATAATTTTTAACTATGTGAACATCTCAGAC
ATATGGAACAGCTCTCAAAAGTCATCTCATGAACTTGTTAAACATAAAAAGAAAAAAGAT
GAAGAAAAGAGCAATTACTCAAAAAAAGATATAGTGACAATAACTTTTTTAATTTTGTTG
CTATTTTGTTATTTTTTACTAATATTTTATTATTGA


>TTHERM_00985030(protein)
MDFTQLIGTLYSTKKENIQCSGEQNKNKWINMLNLLNSFENSQAKSLQSQQQNGLSHSDF
KNSLLKNSTLQLFCQCQEQLEYLVNLQMKFQERGLKLREDLNEQQMLEVGLCFAIILILE
NDFISHEFFGIDQNKTQPAFKSIHKVLNYDYFIDNSSNENLQRYEEITYKTAQSTNNQTE
NISTEKNNELEKYLQTELKHTSSSPQLQSQSPLKIQIQNNQHQKSFSTQNYFSQNLYKNS
QAKCSTISQTNKNQLVSKNQSQNVLFQENHILNLSILFYRFFNSFQMSYDTFSSQTEYSL
SNQFQNAISEQQFNFNFCEKVLRESQKKDESNVFQEQKYITPKRLTTPDAIKLIENNQSI
ISDNKENQKGNVLESNIYTNSFEKSVINQNQDILNFFFEDPSKKLKKSNRHSMDCLGDKM
NDSPMQLKNFHMSKKKEQRFESCVINGNNNLFEESQLIINKLDLQKRRYQQYSQEQSKLI
QELHSLYIDLKTKYESLQQSSLNFSNDQEAKQKVRESQQNFSIENKQKNIVKKSDFQQIN
TQNCEFDNSSVNEQKQNQKNDEQIFESKIIQSSTLSQSNIKTSECNPMTMQLNYQQKNKI
FTENDSDINRRQVHDDILSQNFLFQSVNINQSNCDQLPQQNSLNPEDQQSIIFNYVNISD
IWNSSQKSSHELVKHKKKKDEEKSNYSKKDIVTITFLILLLFCYFLLIFYY


>TTHERM_00985030(gene)
ATGGATTTTACTTAATTGATTGGCACTTTATATTCAACAAAAAAAGAGAATATTTAATGC
TCAGGTGAATAAAATAAAAATAAATGGATTAACATGCTAAATTTACTAAATAGTTTTGAA
AATAGCTAAGCAAAATCTTTGTAAAGTCAGCAATAAAATGGCCTTTCACACTCAGATTTT
AAAAATAGTTTACTCAAAAATAGTACTTTGTAATTATTTTGTTAATGTTAAGAGCAACTT
GAATATTTAGTTAATCTTCAAATGAAATTTCAAGAAAGAGGACTTAAGCTTAGAGAGGAT
TTAAATGAATAGTAAATGCTTGAAGTAGGACTATGCTTTGCAATAATCTTGATTTTAGAG
AATGATTTTATTAGCCATGAATTTTTTGGTATTGATCAAAACAAAACATAACCTGCCTTT
AAAAGTATTCACAAAGTGTTAAACTATGATTACTTTATCGACAATAGCTCGAATGAAAAT
CTACAAAGGTATGAAGAAATTACTTACAAAACAGCTCAATCAACAAATAATTAAACAGAA
AATATTAGCACAGAGAAAAATAATGAATTGGAAAAATATTTGCAAACTGAACTAAAACAC
ACAAGTAGCTCGCCATAACTTTAATCTCAATCACCTTTAAAGATCTAAATTTAAAACAAT
TAGCATTAAAAATCATTTTCAACATAAAACTATTTCTCTTAAAATCTATACAAAAACTCG
CAAGCTAAATGCTCAACAATCTCTCAAACAAACAAAAATTAGCTAGTGAGTAAAAACTAA
AGTTAAAATGTTTTGTTTTAAGAAAATCATATTTTAAACTTAAGCATTCTTTTTTACAGA
TTTTTTAATTCTTTTTAAATGAGTTATGATACATTTTCATCATAAACTGAGTACTCTTTG
AGCAATTAATTCTAAAATGCTATTTCGGAATAATAATTTAATTTTAACTTTTGTGAAAAG
GTTTTGAGAGAAAGTTAAAAGAAAGATGAATCTAATGTCTTCTAGGAATAAAAATACATT
ACTCCAAAAAGATTAACCACACCTGATGCTATTAAATTAATAGAAAATAATTAATCAATT
ATTTCTGATAACAAAGAAAATCAAAAAGGAAATGTTCTGGAAAGTAACATTTACACTAAT
TCTTTTGAAAAGAGCGTAATTAATCAGAATTAGGATATTCTAAATTTTTTTTTTGAAGAT
CCATCAAAAAAGCTCAAAAAATCCAATAGACATTCAATGGACTGTTTGGGAGACAAAATG
AATGATTCACCAATGTAACTTAAAAACTTTCATATGAGCAAAAAGAAAGAATAGAGGTTT
GAATCATGTGTTATAAACGGAAACAATAATCTCTTTGAAGAGAGTTAACTGATAATAAAC
AAACTTGACCTACAAAAAAGGAGATATTAGCAATATTCTCAAGAGCAAAGCAAACTAATA
TAAGAACTACATAGCTTATACATCGATCTAAAAACAAAATATGAGTCTCTTCAGCAATCT
AGTTTGAATTTTTCTAATGATTAAGAAGCTAAACAAAAAGTGAGGGAAAGCCAACAAAAC
TTTAGTATTGAAAACAAATAAAAGAATATTGTAAAAAAAAGTGATTTTTAATAGATTAAT
ACTTAAAATTGTGAATTTGATAATTCATCTGTAAACGAATAAAAACAAAACTAAAAAAAT
GACGAATAAATTTTTGAAAGCAAAATAATTTAATCATCTACTTTGAGCTAGAGCAACATA
AAGACTAGTGAATGTAATCCTATGACAATGTAGCTTAACTATTAGTAAAAAAATAAGATT
TTTACTGAAAACGACTCAGATATTAATAGAAGATAAGTGCATGATGATATTTTAAGTTAG
AATTTTTTATTCTAAAGTGTAAACATAAACTAAAGCAATTGTGACTAACTTCCTTAACAA
AATAGTTTGAACCCTGAAGACTAACAATCAATAATTTTTAACTATGTGAACATCTCAGAC
ATATGGAACAGCTCTCAAAAGTCATCTCATGAACTTGTTAAACATAAAAAGAAAAAAGAT
GAAGAAAAGAGCAATTACTCAAAAAAAGATATAGTGACAATAACTTTTTTAATTTTGTTG
CTATTTTGTTATTTTTTACTAATATTTTATTATTGA