Identifiers and Description

Gene Model Identifier

TTHERM_00976510

Standard Name

None

Aliases

PreTt21737 | 182.m00047

Description

Neurohypophysial hormones, N-terminal Domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF07620 ) SLEI
  • ( PF00412 ) LIM domain
  • ( PF00622 ) SPRY domain
  • ( PF07699 ) GCC2 and GCC3
  • ( PF01363 ) FYVE zinc finger
  • ( PF08746 ) RING-like domain
  • ( PF02822 ) Antistasin family
  • ( TIGR01612 ) rhoptry protein
  • ( PF00451 ) Scorpion short toxin
  • ( PF01754 ) A20-like zinc finger
  • ( PF09257 ) BCMA, TALL-1 binding
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF05453 ) BmTXKS1/BmP02 toxin family
  • ( PF03638 ) Tesmin/TSO1-like CXC domain
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF02420 ) Insect antifreeze protein repeat
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF07829 ) Alpha-A conotoxin PIVA-like protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01053 ) zinc finger domain, LSD1 subclass
  • ( PF07562 ) Nine Cysteines Domain of family
  • ( PF03302 ) Giardia variant-specific surface protein
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich
  • ( PF00220 ) Neurohypophysial hormones, N-terminal Domain
  • ( PF00228 ) Bowman-Birk serine protease inhibitor family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.3%

TetraMine Data

TTHERM_00976510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41166.19.997093137033517e-262hypothetical protein (844 aa)
OxytrichaContig18862.0.g771.0001055852164665e-60hypothetical protein
Stentor CoeruleusSteCoe_269501.9792598779469045e-32
WormBaseWBGene000022990.000008000552149328928locus:let-23 status:Confirme
d UniProt:B5BM28 protein_i
d:CAR31510.1
DictyBaseDDB_G02786130.000050024383570459175DDB_G0278613 on chromosome: 3
position 358498 to 361472

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00976510(coding)
ATGTCTGCTTCACTGAATAAAAGATTATTTTAATGTTATTAATTATCAAATTATCTAACT
ATCTATTTATCTAGATTTAATTAAGAGCAAAAACAAATAAATAAATAAACAAACAAACAA
ATAAAATAATAGCAAAAATCAAACAATTAATTAAATGTAAGTAGAAAATAAAAAAATAAG
TTAAAGAATGAACTAAAAAATATTAACTTTGTAAAGCATTTTATCAATAATAATTCTCAA
ATTTTGTAATTGCAGTAAAATATTTATAATTTTAAGTACTTCTTAATAATATTTATAATA
TTTTATATAGTAATTGATTATCCAGCATTGACAATAGATGGTTTTAACATTGCTAAGTTT
AAAGATGATTACAATTTGTTTGATTGCACTTACTCTCAAGATGATACCTAATTTTTTAGG
TCTTATTTAGGATAATTTACTTGCTAGAATGATGGAGTTAAATCTAAAAATAATGCTTTA
TTTAAAATAGATATCCAAGTACCATATTATAGAAGCTCAGTATCATTTGATATGATATAT
ATGTAAGCTCTAAACAATTAAAAAATAGAAGTTAAAATTGATGACACAAGCTAAGTACCT
ATATTATTTGATTAGAAAAGTAAATTAATAGCTAATTGTAATAAAGCTAGCAATAGATTA
TTATAGGCATTTGATTATAAAAATTATATCTAAAATTAAAGATTCTTACAAATAAACACA
AATCAAGAAAAATCATTTTCTAGTGATGACCTGCTCATCCAGCAATATTATTCTGGATAA
TATTCATTCAATGGTTATACAAAGTAGAAAATTGTAAGTTTTTAAGAGTAATGCTAGGAT
TAGAGCTATTTTCGCCTAATGTCACTTCAAATTTCATTAAATACTTGTCATCCTACTTGC
TTTGAGTGTAGTGGGCCAAGCGAGTCTAATTGCACGAAATGTTATGAAAATAATCCATAA
AGCGGAAAATGCTCATGTTCTGACCCTAAAAAGGTATTATATAAAGGTTAGTGCTCTGAT
TCATGTGATCAATCTGAATATTGGTTCTAGTTTAATAATATTTGCATTTTTTCTAAATAT
TGCAGCCTTTGGGATAGTTTTAAAGGAGTTTGTTTAAAATGTGAGAAAAATATGCCAATA
TTCTAAGGTTAATGCATTGAAGATTGTCCTACTTCTTATACAAAAGCTAATATTTCAACT
AGACCATATTGCTAATTTAACATAGAAGATATTTAAGGAGAATTTCTTTTTCAAGGACTG
ATCACAAATGATTTTTCGATTTTAGAGATACAAAATCTTGGGTTTCAGTGGTCTGGATTT
AACTTCTAAAATTAATCAAATGGTGGCATAGTTTCTAAGTGCAATACTTTCTAGCTCTTT
GGGGGATTTTTTTTAAATGTATTTAAAAGCGAAATATAAATTTCTTTTACAAACAACAAA
AAGTACAAAAAATTTAAATTAGCATTCAAGTATATAGCAATCGATATTCCTGATTAAGCA
GAAGACTTCACTATCGCTAGTGTTTCTGTAAATAATGGGAAAAAAGTGGTTGATGTTAAT
TATTAAAAATCTTCTGACTAGAACTCTCCAAACATTTGTGGAATGAATCAAATTGATAAA
ATGGGAGAATTTTTAGATTCTTTTGACATAGATTCAAAAAGTGAAAGCACTCAAATTAAG
ATCACTAATCTGTCTCCTTAATCTTACTTTGGCATAAGAGAAATTTTTGCTTATGCATAC
AATTGCGAATTACCAAAATGTATCAGCTGTTTTAATTAAAATATGTGCACTTAATGTATG
GAAGGTTATTATACTGTTAAAGTCAATAATGATATGAGCTGTAAAAAATGCTCTTCAAAT
TGCTTAACTTGTAAGGATTCTCCTACATCCTGTGTTACCTGTGCTGTAAATATGTACTTA
GATAAAGGTGTTTGCAAATGCAATTAGAATTATCAGATGGATCCAAATACTTAGAGGTGT
TTTAAATGCTAAGACTAATAAAAATGCTCAGTTTGCTTACCTGAAAACGATAATGCTTGC
TCTGAATGTTAAAAAGGCTTTTTTCTTCTAGGATAGAAATGTGTTGATGATTGTGGACCT
AACTACTTTAAAAATTCTTAAAGTAAAACTTGTGATTAGTGTCCTTCAAACTGCATATAA
TGCTTAGATTAAAATACATGCAGAGAATGTTCTAAAGGCTCTTTTATTACTATTAATAAT
TAGTGTACTAAGACTTGTCCAGATGAAACATACTATCCTGATCCTAATAAAAAAAGATGC
ATTAAATGTAAAGATCCGCAATGTTCAAGTTGCTAATTAGGTGATGATAAATGCTAAAAA
TGTAACAATCCTTTTAATTTGATGGTAAATATTTGCTAATCTACATGTGATTAAGGATTT
GGACCTGATGAAAACAGAATATGTAGAAAATGTAGTGAAATTTACAGTGGATGCTCAAAA
TGTACTTCAGGATAGTGTATTGAGTGTAATAGTTCACAATATTTCTTAGAAGGTCAAAAC
GGAAAATCTCCATGCGTTGATTCTTGCCCCTCAAATTATTACTCAAATTCTAGCAAAGTT
TGTAAAAAATGTGAAAACTTAAATTGTGAAGTTTGCAGTAGCAGCAATCCAAAAACTTGT
ACGAAATGTAATTCCAAATTACCCCTTATGTAAAATGGGGATTGCGTGTAGAGTTGCGAT
ATTTCATATTATTAGCAGAATTCGTCAACATGTTAATTGTGTAGTGCGTTATTTTAAGGG
TGTTTTAAATGCACATAATAAAATTGCTTATCTTGTACTGATAAAAGTCAATATTTAATT
TAAGATTAAAATAAATGTTCAGCAAGTTGTAATATTGATAAATACTATCCCGCAGTGACA
GATAATTAGAATCTTTGTTTGAAATGCCCAAACGCAGTTTGTCTGAAATGCGATCCTAAT
TCTCCTCAAAATTGCACCTAGTGTCCATAAAATATGCTTTTGCAAGAAATTAATTGCGTT
CTCTCTTGTAGTGAAGGGTTTGTAAAGTCCCAGAATAACGAATGTCGTAAATGCTCAGAT
GTTTTCCCTAAATCAAATTGTGCAAAATGCACTGCTACTCAATGCACAGGATGCTTAGAT
GGATAGTATTTATTAAGTGAATAATAAACTTGCTATTCAAATTGTCCTGATGGTTACTTC
TAAAATACGAAGTCAAGTTAATTAGTGTGTTCATAATGTCCTCAAAAATGCTCATTATGT
GACTCAATTACTTGCTTTTAATGTTAGGAGAAAGCATTTAAACATGAAAACAAATGCTTA
GACTAATGTCCAGAAGGATTTATTTCTGATGATAAATTCATTTGTTAGACTTGCTCAAAT
AAATTTCCTAATTGTTAAAAATGCACAACGGACAAATGTACTTAATGCGCAAATAACTTT
TATTTGAATGTATTAACTTAGAATTGTGTCAACAAATGCCCTGATGGAATGACTGAAAAT
TCTGATTCTGGGTATTTATAATGCGTTTAGAGTTGCACTGTAAAAGATTGCGCTAAGTGC
GATCAAAATTAAATCTGTTTGAAATGTGATAGTAAATCTTCAAATCCTCTTTTACAGTCT
TAGATATGTGTAAATTCATGTTCAGCAGGTTTCTATTAAGGACAAGCAGGCAGTGAAAAC
GCTTTTAACTGCTTAAAATGTTCTGATACATACTCTAATTGCGAGTCCTGCGACAGCTAA
AATTGCATTTAGTGCTCATCTTCTTATCCTATTTACGATCCAAATAAAAAATCCTGCTTG
AATTAATGTCCTGCAGGCTATTATGAAAATTAAAAAACCTGCAAAAAATGTTTAAGCCAA
AATTGCTAAATTTGTGATTAATAAAACAGTAATAATTGTCTTTAGTGTATCGAGAATTCG
AATTTTTCATTTCTTTCAAACGGCAAATGTGTTGATACATGTCCTAGTGGGTATGGACCT
TAAAATGGAGTTTGTTAATAGTGCTCTAAAATCTACTAAGAGTGTTAAGATTGCAATGCT
ACAGGATGTATTTCATGCAAAAATAATCAGAAATACCTTCATAAGAATCTTGGCTGCTTT
ACCTAGTGTGAAGAAGGATATTACAATGACAGCTCTGGTTCAATTAGAGAATGTAAAAAA
TGCTAAACAAATAGTGACTGCATTATTTGCCAAGCTTCAAATCCAACTCGTTGCTAAGTT
TGTAAATTGCCTTTGTTCAATTAAGTTGGAGTATGCTAAGAAAAATGTGATGAAGGATAT
TTAGTAAATAAAGTTAGCTACAAATGTATGGAAAGATGCGATGTAGTTTATCCAGGATGC
TTAGCATGCAATACGATAGATTTTTGTACTAAATGCATAGATTCTAATAATTATATATAA
TCAGACAAAAATTCTTGCAAACCAACCTGCGATTTAGGATCAGTTGGCACTAAAGATCAA
GAAGGAACAAATGTTTGTTTATCATGCTAAGACCCTAACTGCAATAAATGCGACCCTGAA
AACTAATTTAAATGCTTGGAATGCTCTTCTAGGTACCAATTAATAAAAATTTCTGAAAAT
TCAGTGAAATGTGTTAAAGATTGTCCAGCAACTCACTTCAAAGAGCAGTATAAAAACGTT
TGCACTCTCTGTTAGAGTAAGTTTAAAATGTGTGAACAATGTGATTCAAATTAATGCTAA
AAATGTTAATTTGAGAATCAAATTTTGTTATCTGATCAATCAGCTTGCGTCTTAACTTGT
CCGCCAGGGTAATTTGCTAGCAGCATGCTAATAAACGGAAACAAAAGGCTTATTTGCAAG
GCCTGTGATAACAAAGATTGTTCTACTTGTGATCCAATTAATCCTTAAAACTGCCTTTCG
TGCAGTAATTCAAGTTAGTATCTCTCCTCTAATAAGTGTGTAGATAAGTGTCCTGCAGAT
TAATATATCGACGAAGAAACAATGTCTTGTTTAAAAACTTGCACGGGAGATAAAATACCT
AATTTAAAAAGCAAAAAATGTGAGATTTGCAAAGATATTGTTTTCAATGGAACTTGTGTT
AATGAATGTCCAAAAGGGCTTCTTGCTTAAAATAAGTCCTGTGTCAGTTGTGATAAAGCA
TTTAATATTTATTGCATAGAATGTTCAACTAACTCTTCAGGTGTATAAACTTGTGATAAG
TGTTCTTAAAAGAAATTGTTATTTAATAACACCTGTGTAGATAGTTGTCCTGATGGGTAT
ATAGCTAATTCTTAAAACATGATTTGTGAATAAATAAAAGATTGTGAGAAAGGCACTTAT
TTAGATAAAAACGCTAATTAATGCTTGAAATGTAAACAAAATTGTTAAGAATGTTCAGAT
TCTTAGACTTGCAAGAATTGTCAAGATGGATTTGTTTTAGTTAAAGAGAGTCAAGAGTGT
GCTGTGTAATGTCCGAATGATAATTATTAAGAAGATTAAGTCTGCTTAAAATGCCCAAGC
AACTGTTTGAGTTGTACTTAAAAAGATTAATGCACATAATGCTAAAAATAATTCTTTTTC
TAAGAAGGATTGTGTGTTGATTAGTGTAAGAACAAATTTGTCAAATTAGAAGATCGCTGT
GTTGAGAGTTGCCCAAAAGAATACTCATTGGATAAAGATTTAAATTAATGTATGAAATGT
CCTAAAAATTGCTCTGAATGCAATCAAAAGCTTGAATGCTAGAAATGCAAAGATAATTAT
TTGTTATAACAATATTTATGTGTAGAATAATGCTCTTATGGTTATTAAGAAAATAAATAA
GATAAAACATGTGAGCAAATTATAAAATGCCCATCAGGAAAATTTTTAGATTAAGATAGT
AAAGAATGCTAATCTTGTAGTGTTAACTGTTTGGAGTGTTTCAATTAAACCTAATGTATT
ACATGTGAAGATGGATTTTACTTTGTAAAAAGTACTTAATAATGCTCAAAACCATGCCCT
GAAAATACATATGTTTAAAATTAATAATGCATCAATTGTCCATAAAATTGCTAAAATTGT
AAAGATTCTGATTTTTGTGATTCCTGCTAAAACTCCTTTTTTAAATATAAAGGAAAATGC
TTTGATAAATGTGAAAAGCCACTTAAGCAGCTAAATAATGAATGTGTTGAAGAATGTCCT
GATGGATATTCTTATGACATTGATTCTAATTTATGCTACAAATGCCCAGAAAATTGTAAA
GATTGTAACATAAATCTTGATTGCTTAAAATGTAAAATTGACTTCTTACTTTAATCAAAA
ACATGTGTAAAAGAATGTTCCAAAGGGTATAAGGAGAATAAGTAACTTTAAACGTGTGAA
GAAGTTATTGATTGTCCTAAAGGAACATTTTTAGATGAAAAAACAAACTCTTGCTTAAAA
TGTATTCCTAATTGTGAAGAGTGCAAGGATAATTCTCAATGTCTTATTTGTAAATAAAGA
TTTTTCCTAATCAAAAGCACTTCATAATGTTCTGATAGTTGCCCAGAAAAAACTTACATT
TATGGAAATTTGTGTTTAAATTGCCCAGAAAATTGCTTATTTTGTAAGAATAAAGACATG
TGCGATAAATGCCTTGAAGGATATTTTGCATTCAAAGGAAATTGTTTAGATAAATGTGAA
AACCCTTTAATATAATTTAATAACGAGTGTATTGAGCGTTGTCCTGAAGGATATTCAAAG
GATAATGATTCTAATTCATGCATTAAATGCCAAGAAAACTGCATTGAATGTAACAAAAAC
CTTGAATGTACCAAATGCAAAAATGATCTCTTACTCGAATCAAATGTATGTGTTAAAGAA
TGCTCATAAGGATATAAGGAGAATAAATAACAATAAAAATGTGAAAAAATCACTTCTTGT
CCTAAAGGAACATTTTTAGATGAAAAAACAAATACTTGCTCAAATTGTGGTTCTAATTGT
GAAGAATGTAAAGACGAATCTCAATGTGTATCTTGTTAATAAGAATTTTTGTTAATCAAA
AGTACTTCATAATGTTCTGATAGTTGCCCAGAAAAAACATACAGTGATGGGAAATTGTGT
TTAAATTGCCCATAAAATTGCTTAGATTGTAAGGATAAAGGTATTTGTAATAAATGCTAA
TAAGGATATTTTGCATTCAAAGGAAATTGTTTGGATAAATGCGAAAAACCATTAATACAA
TTTAATAGTGAATGTGTTGATATTTGTCCTCAAGGATATTCAAAAGATAATGATTCCAAT
ACATGCATCAAATGCTAAGAAAACTGTACTGAGTGTAACAAAAACCTTGAATGCTTCAAA
TGCAAAAACGATCTCTTACTATAGTAAAAAGCTTGTGTAACTGAATGCTCAAAAGGATAT
AAAGAAAATAAATAAAATCATGAATGCGAGTAAATAACGGATTGTCCTTTAGGTAATTAT
TTAGACTAAAACACCAAAATTTGTCAGAAATGTAGTACTAACTGCTAAGATTGCTTTGAA
TCACCTACCACTTGTACATCTTGCAAGAATCTATTTTTAATGATTAAGGACTCCTAAATA
TGTGTTGATAAATGTCCAAAAAATATGTATCAAAGTGGAAAACTTTGCTTAAAATGTCCT
GAAAACTGCAAAGATTGTGATTTATTTGGAAATTGTTAAAATTGCGAAGAAGGTCATTAT
CAATATTAAGGTAAATGCCTTGATTAATGCAAGACACCTTTGATTGTTAAAGGTTAAAGC
TGTGTAGAAAAATGCCCTGAAGGTTTTTCGCACAACATATAAAAAAATGAATGCATTGAA
TGTAAATAAAATTGCTTAGATTGTGATTAAAATTCTTTATGCACAAGATGTAAATAGGAT
TATTTAATTTAATAAGGCCTTTGTGTTCCTAATTGCGAAAAAGGGTATTTTAAGTAAGGT
AATAATTGTTAGAAATGTAGCTCTAATTGCTTAAGTTGTGATATTTCAGAAGATTCATGT
ATTGAATGCAATACAAGTTAAGGTATTTATAAAGTTGGCAAAGAATGTAAACATTGCTAT
GGAATTCAAGGTGTGGAATACTCTGAGAAATCAAAGCAATGTGTAGAATTATGTGGTAAG
GGATTTGTTATAAAACCAGATATTTTAAAGAAATACTAAATATCTTCTAAAATCTAATGT
GATTTAGGTGATTCTGAAAGCAAAAATGGATGCACTGAACAATGCATAATAAAATAAGGC
TATGAGTGCAAGAAATACTTTGAAGATTAATTTATATTGAAACAAACATGTAAAATAAAA
TCAGATGGACCTTCTCCTCAACTAAATTTAGTAGAAATCTAAAAAGCTGATGATGGTTAT
TAAATAATTTGCTAAGTTTAATTTGATAGACATGTTAAAGTTTCGAACTACTCAGAGTGG
AGACTTCAAATGTAAAATAAGTTAGGATAGGATCTTCAATTTAATTACAAGATTTCTCCT
TTATACAACTAAACTGATTAATTGTTAAAACATAAATTTAACATCTTTATAAAAATGCAA
GAAAACTTTTAGAATTCAACTTTAACTTTGCATTTCCCAAACGAAGATTCTGTGAAGGAC
ATTAATGAACAAAGCTTAATAAAATTATAAGCTAATTTAGAATTATAATTAAATGAAAAC
TATAAAGATGATTATTTAGAAGATGAAATGAAGAAAAATAAAAAATAATAAAGCACTATT
TCTATTTCTCTTGGTTCTATCTCATTAAGCTGCACTCTTTTGATGATTTTTATAACTAAG
TTTTATGATTTTGTTAGCATTTTCGATATCCTGTAAGTTATAAACTACTTAATTTACCTA
AATGTCAATATACCTAATTTAGCATACCAAACAATGAGAGTTTTTGATTTTGCCAATTTT
GAAATAATTCCAAATAAACACAAGTCTGAATCAAGTGCTCCAGTTCAATTCTAAATTGAA
AATTATGACACATTTTTCTTTTCAAACATGATACAAGTTGCTGCTATTTGGGGTTTCAGC
ATCTTCATATATTTGATCTCTAAATTAATTGTCAAGTATGTTAGAATCTAATTCCTTCAA
TTTATATTTAGACCTTATGAAAGAAAATTTAAATATTTCATCATAGTTGGAATAGCATTT
TTAACTAGTCATGACATAATACTAGCTTCTCTTTTGCAGCTATATGAAACAAACTTAACT
AATATCTAGATACTTGGTGTTATTTTTTCTGTAGCAAGCTTGCTATTTATATCAGGTCTC
ATTATTCTATCAACTTAATCACACCACTTGACAAGATATCCTTCATTACAAATGAGTGAT
TAAAACTCTTAAAAGCATTCATTTTTGCTGTAAAACCTAAAACCTCATAAAAGCATTTAC
AATACTTTTCTGATAGCGAGAAAAATAGTGTTTATTATATCTTTGATATACTTCAGATCT
CCTATTTAACAATGCATGATCATACATTTCATATTTGGATTAGAGTTGATAGTACTCGTT
TAATTCTAACCATTTACCTTAAAAACAGATAACAATATTCAAGTTATATGCAAAGGATTG
CTAATATTTTCAATTACTATAATTACATTCATAGCTTACTAAAGTTAAGTTAACACAGAA
ATAAATGAAAATCTTAATGCCATACTAGGAGTAGCTCTCTCAGTGATATTTACAATTATT
TTCCTCATACAATTTTTAAGTGTAGTCATCAAAGCTATAATCAAGTTCAGATCTAATACT
TTCAGCTAAAAGTTTATTAATAAAATATGA


>TTHERM_00976510(protein)
MSASLNKRLFQCYQLSNYLTIYLSRFNQEQKQINKQTNKQIKQQQKSNNQLNVSRKQKNK
LKNELKNINFVKHFINNNSQILQLQQNIYNFKYFLIIFIIFYIVIDYPALTIDGFNIAKF
KDDYNLFDCTYSQDDTQFFRSYLGQFTCQNDGVKSKNNALFKIDIQVPYYRSSVSFDMIY
MQALNNQKIEVKIDDTSQVPILFDQKSKLIANCNKASNRLLQAFDYKNYIQNQRFLQINT
NQEKSFSSDDLLIQQYYSGQYSFNGYTKQKIVSFQEQCQDQSYFRLMSLQISLNTCHPTC
FECSGPSESNCTKCYENNPQSGKCSCSDPKKVLYKGQCSDSCDQSEYWFQFNNICIFSKY
CSLWDSFKGVCLKCEKNMPIFQGQCIEDCPTSYTKANISTRPYCQFNIEDIQGEFLFQGL
ITNDFSILEIQNLGFQWSGFNFQNQSNGGIVSKCNTFQLFGGFFLNVFKSEIQISFTNNK
KYKKFKLAFKYIAIDIPDQAEDFTIASVSVNNGKKVVDVNYQKSSDQNSPNICGMNQIDK
MGEFLDSFDIDSKSESTQIKITNLSPQSYFGIREIFAYAYNCELPKCISCFNQNMCTQCM
EGYYTVKVNNDMSCKKCSSNCLTCKDSPTSCVTCAVNMYLDKGVCKCNQNYQMDPNTQRC
FKCQDQQKCSVCLPENDNACSECQKGFFLLGQKCVDDCGPNYFKNSQSKTCDQCPSNCIQ
CLDQNTCRECSKGSFITINNQCTKTCPDETYYPDPNKKRCIKCKDPQCSSCQLGDDKCQK
CNNPFNLMVNICQSTCDQGFGPDENRICRKCSEIYSGCSKCTSGQCIECNSSQYFLEGQN
GKSPCVDSCPSNYYSNSSKVCKKCENLNCEVCSSSNPKTCTKCNSKLPLMQNGDCVQSCD
ISYYQQNSSTCQLCSALFQGCFKCTQQNCLSCTDKSQYLIQDQNKCSASCNIDKYYPAVT
DNQNLCLKCPNAVCLKCDPNSPQNCTQCPQNMLLQEINCVLSCSEGFVKSQNNECRKCSD
VFPKSNCAKCTATQCTGCLDGQYLLSEQQTCYSNCPDGYFQNTKSSQLVCSQCPQKCSLC
DSITCFQCQEKAFKHENKCLDQCPEGFISDDKFICQTCSNKFPNCQKCTTDKCTQCANNF
YLNVLTQNCVNKCPDGMTENSDSGYLQCVQSCTVKDCAKCDQNQICLKCDSKSSNPLLQS
QICVNSCSAGFYQGQAGSENAFNCLKCSDTYSNCESCDSQNCIQCSSSYPIYDPNKKSCL
NQCPAGYYENQKTCKKCLSQNCQICDQQNSNNCLQCIENSNFSFLSNGKCVDTCPSGYGP
QNGVCQQCSKIYQECQDCNATGCISCKNNQKYLHKNLGCFTQCEEGYYNDSSGSIRECKK
CQTNSDCIICQASNPTRCQVCKLPLFNQVGVCQEKCDEGYLVNKVSYKCMERCDVVYPGC
LACNTIDFCTKCIDSNNYIQSDKNSCKPTCDLGSVGTKDQEGTNVCLSCQDPNCNKCDPE
NQFKCLECSSRYQLIKISENSVKCVKDCPATHFKEQYKNVCTLCQSKFKMCEQCDSNQCQ
KCQFENQILLSDQSACVLTCPPGQFASSMLINGNKRLICKACDNKDCSTCDPINPQNCLS
CSNSSQYLSSNKCVDKCPADQYIDEETMSCLKTCTGDKIPNLKSKKCEICKDIVFNGTCV
NECPKGLLAQNKSCVSCDKAFNIYCIECSTNSSGVQTCDKCSQKKLLFNNTCVDSCPDGY
IANSQNMICEQIKDCEKGTYLDKNANQCLKCKQNCQECSDSQTCKNCQDGFVLVKESQEC
AVQCPNDNYQEDQVCLKCPSNCLSCTQKDQCTQCQKQFFFQEGLCVDQCKNKFVKLEDRC
VESCPKEYSLDKDLNQCMKCPKNCSECNQKLECQKCKDNYLLQQYLCVEQCSYGYQENKQ
DKTCEQIIKCPSGKFLDQDSKECQSCSVNCLECFNQTQCITCEDGFYFVKSTQQCSKPCP
ENTYVQNQQCINCPQNCQNCKDSDFCDSCQNSFFKYKGKCFDKCEKPLKQLNNECVEECP
DGYSYDIDSNLCYKCPENCKDCNINLDCLKCKIDFLLQSKTCVKECSKGYKENKQLQTCE
EVIDCPKGTFLDEKTNSCLKCIPNCEECKDNSQCLICKQRFFLIKSTSQCSDSCPEKTYI
YGNLCLNCPENCLFCKNKDMCDKCLEGYFAFKGNCLDKCENPLIQFNNECIERCPEGYSK
DNDSNSCIKCQENCIECNKNLECTKCKNDLLLESNVCVKECSQGYKENKQQQKCEKITSC
PKGTFLDEKTNTCSNCGSNCEECKDESQCVSCQQEFLLIKSTSQCSDSCPEKTYSDGKLC
LNCPQNCLDCKDKGICNKCQQGYFAFKGNCLDKCEKPLIQFNSECVDICPQGYSKDNDSN
TCIKCQENCTECNKNLECFKCKNDLLLQQKACVTECSKGYKENKQNHECEQITDCPLGNY
LDQNTKICQKCSTNCQDCFESPTTCTSCKNLFLMIKDSQICVDKCPKNMYQSGKLCLKCP
ENCKDCDLFGNCQNCEEGHYQYQGKCLDQCKTPLIVKGQSCVEKCPEGFSHNIQKNECIE
CKQNCLDCDQNSLCTRCKQDYLIQQGLCVPNCEKGYFKQGNNCQKCSSNCLSCDISEDSC
IECNTSQGIYKVGKECKHCYGIQGVEYSEKSKQCVELCGKGFVIKPDILKKYQISSKIQC
DLGDSESKNGCTEQCIIKQGYECKKYFEDQFILKQTCKIKSDGPSPQLNLVEIQKADDGY
QIICQVQFDRHVKVSNYSEWRLQMQNKLGQDLQFNYKISPLYNQTDQLLKHKFNIFIKMQ
ENFQNSTLTLHFPNEDSVKDINEQSLIKLQANLELQLNENYKDDYLEDEMKKNKKQQSTI
SISLGSISLSCTLLMIFITKFYDFVSIFDILQVINYLIYLNVNIPNLAYQTMRVFDFANF
EIIPNKHKSESSAPVQFQIENYDTFFFSNMIQVAAIWGFSIFIYLISKLIVKYVRIQFLQ
FIFRPYERKFKYFIIVGIAFLTSHDIILASLLQLYETNLTNIQILGVIFSVASLLFISGL
IILSTQSHHLTRYPSLQMSDQNSQKHSFLLQNLKPHKSIYNTFLIARKIVFIISLIYFRS
PIQQCMIIHFIFGLELIVLVQFQPFTLKTDNNIQVICKGLLIFSITIITFIAYQSQVNTE
INENLNAILGVALSVIFTIIFLIQFLSVVIKAIIKFRSNTFSQKFINKI


>TTHERM_00976510(gene)
ATGTCTGCTTCACTGAATAAAAGATTATTTTAATGTTATTAATTATCAAATTATCTAACT
ATCTATTTATCTAGATTTAATTAAGAGCAAAAACAAATAAATAAATAAACAAACAAACAA
ATAAAATAATAGCAAAAATCAAACAATTAATTAAATGTAAGTAGAAAATAAAAAAATAAG
TTAAAGAATGAACTAAAAAATATTAACTTTGTAAAGCATTTTATCAATAATAATTCTCAA
ATTTTGTAATTGCAGTAAAATATTTATAATTTTAAGTACTTCTTAATAATATTTATAATA
TTTTATATAGTAATTGATTATCCAGCATTGACAATAGATGGTTTTAACATTGCTAAGTTT
AAAGATGATTACAATTTGTTTGATTGCACTTACTCTCAAGATGATACCTAATTTTTTAGG
TCTTATTTAGGATAATTTACTTGCTAGAATGATGGAGTTAAATCTAAAAATAATGCTTTA
TTTAAAATAGATATCCAAGTACCATATTATAGAAGCTCAGTATCATTTGATATGATATAT
ATGTAAGCTCTAAACAATTAAAAAATAGAAGTTAAAATTGATGACACAAGCTAAGTACCT
ATATTATTTGATTAGAAAAGTAAATTAATAGCTAATTGTAATAAAGCTAGCAATAGATTA
TTATAGGCATTTGATTATAAAAATTATATCTAAAATTAAAGATTCTTACAAATAAACACA
AATCAAGAAAAATCATTTTCTAGTGATGACCTGCTCATCCAGCAATATTATTCTGGTAAA
TTTGGATTGAGAGTTATTTTTAACAATATAATTTTTCATATATTTTAATAGGATAATATT
CATTCAATGGTTATACAAAGTAGAAAATTGTAAGTTTTTAAGAGTAATGCTAGGATTAGA
GCTATTTTCGCCTAATGTCACTTCAAATTTCATTAAATACTTGTCATCCTACTTGCTTTG
AGTGTAGTGGGCCAAGCGAGTCTAATTGCACGAAATGTTATGAAAATAATCCATAAAGCG
GAAAATGCTCATGTTCTGACCCTAAAAAGGTATTATATAAAGGTTAGTGCTCTGATTCAT
GTGATCAATCTGAATATTGGTTCTAGTTTAATAATATTTGCATTTTTTCTAAATATTGCA
GCCTTTGGGATAGTTTTAAAGGAGTTTGTTTAAAATGTGAGAAAAATATGCCAATATTCT
AAGGTTAATGCATTGAAGATTGTCCTACTTCTTATACAAAAGCTAATATTTCAACTAGAC
CATATTGCTAATTTAACATAGAAGATATTTAAGGTAAAATTAAAATTTGTAGTAAACTTA
AATAATCAACTTGTTACTAACTAACTAATATTTGAATAGGAGAATTTCTTTTTCAAGGAC
TGATCACAAATGATTTTTCGATTTTAGAGATACAAAATCTTGGGTTTCAGTGGTCTGGAT
TTAACTTCTAAAATTAATCAAATGGTGGCATAGTTTCTAAGTGCAATACTTTCTAGCTCT
TTGGGGGATTTTTTTTAAATGTATTTAAAAGCGAAATATAAATTTCTTTTACAAACAACA
AAAAGTACAAAAAATTTAAATTAGCATTCAAGTATATAGCAATCGATATTCCTGATTAAG
CAGAAGACTTCACTATCGCTAGTGTTTCTGTAAATAATGGGAAAAAAGTGGTTGATGTTA
ATTATTAAAAATCTTCTGACTAGAACTCTCCAAACATTTGTGGAATGAATCAAATTGATA
AAATGGGAGAATTTTTAGATTCTTTTGACATAGATTCAAAAAGTGAAAGCACTCAAATTA
AGATCACTAATCTGTCTCCTTAATCTTACTTTGGCATAAGAGAAATTTTTGCTTATGCAT
ACAATGTAATTTATTTAATAGCTAATTTAATTTCATTTCATTAAATTGGTGGTCAATTTT
TGATCTTGTGGTGTAAAAGATTTATTTTTATTAAACTTTATTTAGATCATCGCAATTAAT
TTAAATTACTGCTCAAATATTACATAATTTCAATTTAATTATTTATCTACTGATTTATTT
TGGCATATTTTACATTTTGTAAATAAAGACAGATCTTATATTTATTCTTTCAAACTTATT
ATTTTCATTTTTAATTAGTGCGAATTACCAAAATGTATCAGCTGTTTTAATTAAAATATG
TGCACTTAATGTATGGAAGGTTATTATACTGTTAAAGTCAATAATGATATGAGCTGTAAA
AAATGCTCTTCAAATTGCTTAACTTGTAAGGATTCTCCTACATCCTGTGTTACCTGTGCT
GTAAATATGTACTTAGATAAAGGTGTTTGCAAATGCAATTAGAATTATCAGATGGATCCA
AATACTTAGAGGTGTTTTAAATGCTAAGACTAATAAAAATGCTCAGTTTGCTTACCTGAA
AACGATAATGCTTGCTCTGAATGTTAAAAAGGCTTTTTTCTTCTAGGATAGAAATGTGTT
GATGATTGTGGACCTAACTACTTTAAAAATTCTTAAAGTAAAACTTGTGATTAGTGTCCT
TCAAACTGCATATAATGCTTAGATTAAAATACATGCAGAGAATGTTCTAAAGGCTCTTTT
ATTACTATTAATAATTAGTGTACTAAGACTTGTCCAGATGAAACATACTATCCTGATCCT
AATAAAAAAAGATGCATTAAATGTAAAGATCCGCAATGTTCAAGTTGCTAATTAGGTGAT
GATAAATGCTAAAAATGTAACAATCCTTTTAATTTGATGGTAAATATTTGCTAATCTACA
TGTGATTAAGGATTTGGACCTGATGAAAACAGAATATGTAGAAAATGTAGTGAAATTTAC
AGTGGATGCTCAAAATGTACTTCAGGATAGTGTATTGAGTGTAATAGTTCACAATATTTC
TTAGAAGGTCAAAACGGAAAATCTCCATGCGTTGATTCTTGCCCCTCAAATTATTACTCA
AATTCTAGCAAAGTTTGTAAAAAATGTGAAAACTTAAATTGTGAAGTTTGCAGTAGCAGC
AATCCAAAAACTTGTACGAAATGTAATTCCAAATTACCCCTTATGTAAAATGGGGATTGC
GTGTAGAGTTGCGATATTTCATATTATTAGCAGAATTCGTCAACATGTTAATTGTGTAGT
GCGTTATTTTAAGGGTGTTTTAAATGCACATAATAAAATTGCTTATCTTGTACTGATAAA
AGTCAATATTTAATTTAAGATTAAAATAAATGTTCAGCAAGTTGTAATATTGATAAATAC
TATCCCGCAGTGACAGATAATTAGAATCTTTGTTTGAAATGCCCAAACGCAGTTTGTCTG
AAATGCGATCCTAATTCTCCTCAAAATTGCACCTAGTGTCCATAAAATATGCTTTTGCAA
GAAATTAATTGCGTTCTCTCTTGTAGTGAAGGGTTTGTAAAGTCCCAGAATAACGAATGT
CGTAAATGCTCAGATGTTTTCCCTAAATCAAATTGTGCAAAATGCACTGCTACTCAATGC
ACAGGATGCTTAGATGGATAGTATTTATTAAGTGAATAATAAACTTGCTATTCAAATTGT
CCTGATGGTTACTTCTAAAATACGAAGTCAAGTTAATTAGTGTGTTCATAATGTCCTCAA
AAATGCTCATTATGTGACTCAATTACTTGCTTTTAATGTTAGGAGAAAGCATTTAAACAT
GAAAACAAATGCTTAGACTAATGTCCAGAAGGATTTATTTCTGATGATAAATTCATTTGT
TAGACTTGCTCAAATAAATTTCCTAATTGTTAAAAATGCACAACGGACAAATGTACTTAA
TGCGCAAATAACTTTTATTTGAATGTATTAACTTAGAATTGTGTCAACAAATGCCCTGAT
GGAATGACTGAAAATTCTGATTCTGGGTATTTATAATGCGTTTAGAGTTGCACTGTAAAA
GATTGCGCTAAGTGCGATCAAAATTAAATCTGTTTGAAATGTGATAGTAAATCTTCAAAT
CCTCTTTTACAGTCTTAGATATGTGTAAATTCATGTTCAGCAGGTTTCTATTAAGGACAA
GCAGGCAGTGAAAACGCTTTTAACTGCTTAAAATGTTCTGATACATACTCTAATTGCGAG
TCCTGCGACAGCTAAAATTGCATTTAGTGCTCATCTTCTTATCCTATTTACGATCCAAAT
AAAAAATCCTGCTTGAATTAATGTCCTGCAGGCTATTATGAAAATTAAAAAACCTGCAAA
AAATGTTTAAGCCAAAATTGCTAAATTTGTGATTAATAAAACAGTAATAATTGTCTTTAG
TGTATCGAGAATTCGAATTTTTCATTTCTTTCAAACGGCAAATGTGTTGATACATGTCCT
AGTGGGTATGGACCTTAAAATGGAGTTTGTTAATAGTGCTCTAAAATCTACTAAGAGTGT
TAAGATTGCAATGCTACAGGATGTATTTCATGCAAAAATAATCAGAAATACCTTCATAAG
AATCTTGGCTGCTTTACCTAGTGTGAAGAAGGATATTACAATGACAGCTCTGGTTCAATT
AGAGAATGTAAAAAATGCTAAACAAATAGTGACTGCATTATTTGCCAAGCTTCAAATCCA
ACTCGTTGCTAAGTTTGTAAATTGCCTTTGTTCAATTAAGTTGGAGTATGCTAAGAAAAA
TGTGATGAAGGATATTTAGTAAATAAAGTTAGCTACAAATGTATGGAAAGATGCGATGTA
GTTTATCCAGGATGCTTAGCATGCAATACGATAGATTTTTGTACTAAATGCATAGATTCT
AATAATTATATATAATCAGACAAAAATTCTTGCAAACCAACCTGCGATTTAGGATCAGTT
GGCACTAAAGATCAAGAAGGAACAAATGTTTGTTTATCATGCTAAGACCCTAACTGCAAT
AAATGCGACCCTGAAAACTAATTTAAATGCTTGGAATGCTCTTCTAGGTACCAATTAATA
AAAATTTCTGAAAATTCAGTGAAATGTGTTAAAGATTGTCCAGCAACTCACTTCAAAGAG
CAGTATAAAAACGTTTGCACTCTCTGTTAGAGTAAGTTTAAAATGTGTGAACAATGTGAT
TCAAATTAATGCTAAAAATGTTAATTTGAGAATCAAATTTTGTTATCTGATCAATCAGCT
TGCGTCTTAACTTGTCCGCCAGGGTAATTTGCTAGCAGCATGCTAATAAACGGAAACAAA
AGGCTTATTTGCAAGGCCTGTGATAACAAAGATTGTTCTACTTGTGATCCAATTAATCCT
TAAAACTGCCTTTCGTGCAGTAATTCAAGTTAGTATCTCTCCTCTAATAAGTGTGTAGAT
AAGTGTCCTGCAGATTAATATATCGACGAAGAAACAATGTCTTGTTTAAAAACTTGCACG
GGAGATAAAATACCTAATTTAAAAAGCAAAAAATGTGAGATTTGCAAAGATATTGTTTTC
AATGGAACTTGTGTTAATGAATGTCCAAAAGGGCTTCTTGCTTAAAATAAGTCCTGTGTC
AGTTGTGATAAAGCATTTAATATTTATTGCATAGAATGTTCAACTAACTCTTCAGGTGTA
TAAACTTGTGATAAGTGTTCTTAAAAGAAATTGTTATTTAATAACACCTGTGTAGATAGT
TGTCCTGATGGGTATATAGCTAATTCTTAAAACATGATTTGTGAATAAATAAAAGATTGT
GAGAAAGGCACTTATTTAGATAAAAACGCTAATTAATGCTTGAAATGTAAACAAAATTGT
TAAGAATGTTCAGATTCTTAGACTTGCAAGAATTGTCAAGATGGATTTGTTTTAGTTAAA
GAGAGTCAAGAGTGTGCTGTGTAATGTCCGAATGATAATTATTAAGAAGATTAAGTCTGC
TTAAAATGCCCAAGCAACTGTTTGAGTTGTACTTAAAAAGATTAATGCACATAATGCTAA
AAATAATTCTTTTTCTAAGAAGGATTGTGTGTTGATTAGTGTAAGAACAAATTTGTCAAA
TTAGAAGATCGCTGTGTTGAGAGTTGCCCAAAAGAATACTCATTGGATAAAGATTTAAAT
TAATGTATGAAATGTCCTAAAAATTGCTCTGAATGCAATCAAAAGCTTGAATGCTAGAAA
TGCAAAGATAATTATTTGTTATAACAATATTTATGTGTAGAATAATGCTCTTATGGTTAT
TAAGAAAATAAATAAGATAAAACATGTGAGCAAATTATAAAATGCCCATCAGGAAAATTT
TTAGATTAAGATAGTAAAGAATGCTAATCTTGTAGTGTTAACTGTTTGGAGTGTTTCAAT
TAAACCTAATGTATTACATGTGAAGATGGATTTTACTTTGTAAAAAGTACTTAATAATGC
TCAAAACCATGCCCTGAAAATACATATGTTTAAAATTAATAATGCATCAATTGTCCATAA
AATTGCTAAAATTGTAAAGATTCTGATTTTTGTGATTCCTGCTAAAACTCCTTTTTTAAA
TATAAAGGAAAATGCTTTGATAAATGTGAAAAGCCACTTAAGCAGCTAAATAATGAATGT
GTTGAAGAATGTCCTGATGGATATTCTTATGACATTGATTCTAATTTATGCTACAAATGC
CCAGAAAATTGTAAAGATTGTAACATAAATCTTGATTGCTTAAAATGTAAAATTGACTTC
TTACTTTAATCAAAAACATGTGTAAAAGAATGTTCCAAAGGGTATAAGGAGAATAAGTAA
CTTTAAACGTGTGAAGAAGTTATTGATTGTCCTAAAGGAACATTTTTAGATGAAAAAACA
AACTCTTGCTTAAAATGTATTCCTAATTGTGAAGAGTGCAAGGATAATTCTCAATGTCTT
ATTTGTAAATAAAGATTTTTCCTAATCAAAAGCACTTCATAATGTTCTGATAGTTGCCCA
GAAAAAACTTACATTTATGGAAATTTGTGTTTAAATTGCCCAGAAAATTGCTTATTTTGT
AAGAATAAAGACATGTGCGATAAATGCCTTGAAGGATATTTTGCATTCAAAGGAAATTGT
TTAGATAAATGTGAAAACCCTTTAATATAATTTAATAACGAGTGTATTGAGCGTTGTCCT
GAAGGATATTCAAAGGATAATGATTCTAATTCATGCATTAAATGCCAAGAAAACTGCATT
GAATGTAACAAAAACCTTGAATGTACCAAATGCAAAAATGATCTCTTACTCGAATCAAAT
GTATGTGTTAAAGAATGCTCATAAGGATATAAGGAGAATAAATAACAATAAAAATGTGAA
AAAATCACTTCTTGTCCTAAAGGAACATTTTTAGATGAAAAAACAAATACTTGCTCAAAT
TGTGGTTCTAATTGTGAAGAATGTAAAGACGAATCTCAATGTGTATCTTGTTAATAAGAA
TTTTTGTTAATCAAAAGTACTTCATAATGTTCTGATAGTTGCCCAGAAAAAACATACAGT
GATGGGAAATTGTGTTTAAATTGCCCATAAAATTGCTTAGATTGTAAGGATAAAGGTATT
TGTAATAAATGCTAATAAGGATATTTTGCATTCAAAGGAAATTGTTTGGATAAATGCGAA
AAACCATTAATACAATTTAATAGTGAATGTGTTGATATTTGTCCTCAAGGATATTCAAAA
GATAATGATTCCAATACATGCATCAAATGCTAAGAAAACTGTACTGAGTGTAACAAAAAC
CTTGAATGCTTCAAATGCAAAAACGATCTCTTACTATAGTAAAAAGCTTGTGTAACTGAA
TGCTCAAAAGGATATAAAGAAAATAAATAAAATCATGAATGCGAGTAAATAACGGATTGT
CCTTTAGGTAATTATTTAGACTAAAACACCAAAATTTGTCAGAAATGTAGTACTAACTGC
TAAGATTGCTTTGAATCACCTACCACTTGTACATCTTGCAAGAATCTATTTTTAATGATT
AAGGACTCCTAAATATGTGTTGATAAATGTCCAAAAAATATGTATCAAAGTGGAAAACTT
TGCTTAAAATGTCCTGAAAACTGCAAAGATTGTGATTTATTTGGAAATTGTTAAAATTGC
GAAGAAGGTCATTATCAATATTAAGGTAAATGCCTTGATTAATGCAAGACACCTTTGATT
GTTAAAGGTTAAAGCTGTGTAGAAAAATGCCCTGAAGGTTTTTCGCACAACATATAAAAA
AATGAATGCATTGAATGTAAATAAAATTGCTTAGATTGTGATTAAAATTCTTTATGCACA
AGATGTAAATAGGATTATTTAATTTAATAAGGCCTTTGTGTTCCTAATTGCGAAAAAGGG
TATTTTAAGTAAGGTAATAATTGTTAGAAATGTAGCTCTAATTGCTTAAGTTGTGATATT
TCAGAAGATTCATGTATTGAATGCAATACAAGTTAAGGTATTTATAAAGTTGGCAAAGAA
TGTAAACATTGCTATGGAATTCAAGGTGTGGAATACTCTGAGAAATCAAAGCAATGTGTA
GAATTATGTGGTAAGGGATTTGTTATAAAACCAGATATTTTAAAGAAATACTAAATATCT
TCTAAAATCTAATGTGATTTAGGTGATTCTGAAAGCAAAAATGGATGCACTGAACAATGC
ATAATAAAATAAGGCTATGAGTGCAAGAAATACTTTGAAGATTAATTTATATTGAAACAA
ACATGTAAAATAAAATCAGATGGACCTTCTCCTCAACTAAATTTAGTAGAAATCTAAAAA
GCTGATGATGGTTATTAAATAATTTGCTAAGTTTAATTTGATAGACATGTTAAAGTTTCG
AACTACTCAGAGTGGAGACTTCAAATGTAAAATAAGTTAGGATAGGATCTTCAATTTAAT
TACAAGATTTCTCCTTTATACAACTAAACTGATTAATTGTTAAAACATAAATTTAACATC
TTTATAAAAATGCAAGAAAACTTTTAGAATTCAACTTTAACTTTGCATTTCCCAAACGAA
GATTCTGTGAAGGACATTAATGAACAAAGCTTAATAAAATTATAAGCTAATTTAGAATTA
TAATTAAATGAAAACTATAAAGATGATTATTTAGAAGATGAAATGAAGAAAAATAAAAAA
TAATAAAGCACTATTTCTATTTCTCTTGGTTCTATCTCATTAAGCTGCACTCTTTTGATG
ATTTTTATAACTAAGTTTTATGATTTTGTTAGCATTTTCGATATCCTGTAAGTTATAAAC
TACTTAATTTACCTAAATGTCAATATACCTAATTTAGCATACCAAACAATGAGAGTTTTT
GATTTTGCCAATTTTGAAATAATTCCAAATAAACACAAGTCTGAATCAAGTGCTCCAGTT
CAATTCTAAATTGAAAATTATGACACATTTTTCTTTTCAAACATGATACAAGTTGCTGCT
ATTTGGGGTTTCAGCATCTTCATATATTTGATCTCTAAATTAATTGTCAAGTATGTTAGA
ATCTAATTCCTTCAATTTATATTTAGACCTTATGAAAGAAAATTTAAATATTTCATCATA
GTTGGAATAGCATTTTTAACTAGTCATGACATAATACTAGCTTCTCTTTTGCAGCTATAT
GAAACAAACTTAACTAATATCTAGATACTTGGTGTTATTTTTTCTGTAGCAAGCTTGCTA
TTTATATCAGGTCTCATTATTCTATCAACTTAATCACACCACTTGACAAGATATCCTTCA
TTACAAATGAGTGATTAAAACTCTTAAAAGCATTCATTTTTGCTGTAAAACCTAAAACCT
CATAAAAGCATTTACAATACTTTTCTGATAGCGAGAAAAATAGTGTTTATTATATCTTTG
ATATACTTCAGATCTCCTATTTAACAATGCATGATCATACATTTCATATTTGGATTAGAG
TTGATAGTACTCGTTTAATTCTAACCATTTACCTTAAAAACAGATAACAATATTCAAGTT
ATATGCAAAGGATTGCTAATATTTTCAATTACTATAATTACATTCATAGCTTACTAAAGT
TAAGTTAACACAGAAATAAATGAAAATCTTAATGCCATACTAGGAGTAGCTCTCTCAGTG
ATATTTACAATTATTTTCCTCATACAATTTTTAAGTGTAGTCATCAAAGCTATAATCAAG
TTCAGATCTAATACTTTCAGCTAAAAGTTTATTAATAAAATATGA