Identifiers and Description

Gene Model Identifier

TTHERM_00961930

Standard Name

None

Aliases

PreTt23681 | 178.m00062

Description

EF hand family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00036 ) EF hand
  • ( PF05391 ) Lsm interaction motif
  • ( PF08537 ) Fungal Nap binding protein NBP1
  • ( TIGR00319 ) desulfoferrodoxin FeS4 iron-binding domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00961930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15851.19.997093137033517e-262EF hand family protein (730 aa
)
OxytrichaContig1716.0.g1102.000130478826482e-26EF-hand domain pair
WormBaseWBGene000002880.0004999512321494991locus:cal-4 status:Confirmed
UniProt:O18058 protein_id
:CAB05271.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00961930(coding)
ATGAGCAATTAAACTTAATAAGATGATAATGAGTATGTCTTTGAAAATCTTAACGAATAT
CAGGCATTTGTGAAAAATAATAAACGCACAAAATTGCACAATAAATCAACTGTTTCATGG
CTTAAAACAAGATACTCCAATAAAACAAAAAAACATTATCTTTTGTTTCCAGAAGAGTTG
ATAGAAGATATGAAAATTCGTAAAATATTCAAAATATTTGATAAGGATGGCTCTCAAGCA
CTTGATTTAAAAGAAATGGTAGAAATGTTTCAAAAGTATAATATCGAAATTGACAAGGAA
GAACTCTAATAAATATATAATATTGTAGATAAAACTAAAGATAATGCATTAAATTACTTA
GAATTTAAAGAATGTGCTATCTCCTAAGATGCTAATGCCATTTTCTCTAAAATGATTTCT
AAAGTACGTACTTAAGAACAACAAAAAAAATCAGCAGAGGAAAGAAACATTTATTTACCT
TAAAGATTCTCAGAAATGGTCACTTATCTTAGCTATAGAATTAATAGAGAGGATTTAGAA
GATTATTTGAGAGAAAGAAATCACAGAATCAGTGAGAGATACGAAAAATATTTATAATTA
ATGAATTTAAATGGGCTTGATTCAGCTGGAGCAACTGCTCACGAAAACCAAATCAAAGAT
TAAAAAAAATTAGATAAGGCTAGTGATCTTGAGTAGAAAATTTTTGATAGGCAATCTAGT
TCAGATTCAGATGGTGAATCTTTAGAAGCTGAAAAGTCTTTTAGAAATTAAATTAAAGAA
GAGCAGTTAAAGAAACAATAAAAAGCATAATATAGACTATCTTAGGCTACAAATTCAGTC
AACAGATCATAACCTCATTTGATGTCTACTTCTCCTAGACATGGCTCACTTTAAATAGAA
CTTTAGGCGTAAAACAGTAATTATTTTTTGCAGTCTTCTGTAGCTGGTGCTTAAACTTAT
GGAACTTAAGGAAGCAATTATAACAACTCAAACTCTTAGTTGGCAGCTTCTAGAGGTTCA
ATTAGGAACTCAAAAATTAGAACATAAGGGAAAAAGGAAATGGATGAGGAGTAAATTCAC
AACAAATTTACCAAATATGAAGCTTAGAGTCTATCTAAAAAGGCTCAGCTCAAAGGAAAG
GATGATGCATAAAATTTATATACTGAAGTATCAAAATAATATGGTACACAAGAAAATTTT
TACAAGACTTTCTAAAGCACTTAAAATTGGTAGAACGCTAACAATGATACTTAAGCTGGT
TTAAAAAATAAAACATAATTATAAACTGATGAGACTGATTCATAATTAGGTAGTGTAGAA
AACAAAAAGTCTGCTGAAAGAAGCAATTTATTACCTCTGTCAACAACATTTTAAAACCAT
AGAGGAGGAATAGGGAAATTCTTTGGAAGTAATGGCTAAGACTTCGAGAGCACTTAGAAT
TCTTAAAATATAAACAATAATATTTACGGAACAAGATAAAAATATTCAAACGATGACTTT
AGACATACTGATTTCAAAGGATTTAATAATAAGAGTCATAATTAGCTAGGAACAATGAGG
AGTGTCAGTTAATTTATGACCAGCAAGAATAAATTTAATAGCACTTTCTATACTCTTGGG
AAGCGTCCTACAACAAATTAAAGCTAATTAAAAACTCTCGGGATAGATAAAAGCTCATTT
AAAAGCATTTGCAATATAATGAATAAAACATTGTTGCAACTAGAGAATAAGAAAATTACA
AACAATTTGTTTATAAAAACAGCTCCTTCGTCTACTAGATTTTCTTATAATAAGCAAAAC
TAGGAAAATAAAGTATAGAATATGAGCTAAAAACTATTGAATTAGAATATAGAGAATAAT
ATAATAGATCCGAAACTAATGCAATCTATTTACAAACCTAACCAGATATAAGAATATTAA
GAAAGAGAGAAATAATTGATAAATGAAATCAAACAAGATATTATGAATAAATTTTTAATG
AACAATCAAGTTGCTGTGTCATTATTTGAAGATTTACAAAAATCAAATTAAAAACCATAT
TATAAAGTTAATCATTCTATCACAACAGAACAATCATTCTTAAAATAAAACAGGCTTCCT
GAATTAGATATGATGAATAAAGTGTACGAAAAAGATAAGACACCTATTGGTAAACACATG
AATAATTAACTTGACAGCAAATATTTAAAAAATTGA


>TTHERM_00961930(protein)
MSNQTQQDDNEYVFENLNEYQAFVKNNKRTKLHNKSTVSWLKTRYSNKTKKHYLLFPEEL
IEDMKIRKIFKIFDKDGSQALDLKEMVEMFQKYNIEIDKEELQQIYNIVDKTKDNALNYL
EFKECAISQDANAIFSKMISKVRTQEQQKKSAEERNIYLPQRFSEMVTYLSYRINREDLE
DYLRERNHRISERYEKYLQLMNLNGLDSAGATAHENQIKDQKKLDKASDLEQKIFDRQSS
SDSDGESLEAEKSFRNQIKEEQLKKQQKAQYRLSQATNSVNRSQPHLMSTSPRHGSLQIE
LQAQNSNYFLQSSVAGAQTYGTQGSNYNNSNSQLAASRGSIRNSKIRTQGKKEMDEEQIH
NKFTKYEAQSLSKKAQLKGKDDAQNLYTEVSKQYGTQENFYKTFQSTQNWQNANNDTQAG
LKNKTQLQTDETDSQLGSVENKKSAERSNLLPLSTTFQNHRGGIGKFFGSNGQDFESTQN
SQNINNNIYGTRQKYSNDDFRHTDFKGFNNKSHNQLGTMRSVSQFMTSKNKFNSTFYTLG
KRPTTNQSQLKTLGIDKSSFKSICNIMNKTLLQLENKKITNNLFIKTAPSSTRFSYNKQN
QENKVQNMSQKLLNQNIENNIIDPKLMQSIYKPNQIQEYQEREKQLINEIKQDIMNKFLM
NNQVAVSLFEDLQKSNQKPYYKVNHSITTEQSFLKQNRLPELDMMNKVYEKDKTPIGKHM
NNQLDSKYLKN


>TTHERM_00961930(gene)
ATGAGCAATTAAACTTAATAAGATGATAATGAGTATGTCTTTGAAAATCTTAACGAATAT
CAGGCATTTGTGAAAAATAATAAACGCACAAAATTGCACAATAAATCAACTGTTTCATGG
CTTAAAACAAGATACTCCAATAAAACAAAAAAACATTATCTTTTGTTTCCAGAAGAGTTG
ATAGAAGATATGAAAATTCGTAAAATATTCAAAATATTTGATAAGGATGGCTCTCAAGCA
CTTGATTTAAAAGAAATGGTAGAAATGTTTCAAAAGTAAACAATTAATTATTGATTTTTG
ATATTGAGCACAAAATTGATTAATATTATCTCATGTATAAAACTTCATTTTTTAGTGAAT
TTTTATCACAAAAACCATTTATTTTGATCAATTTTTGTTTTATTGAGGAAGATTTTGATG
GAAAATTATTTTATTTAAAAATTCTTAATTAATCTTGTATGGTAAGTTTTAAATCAAAGA
CCTTTTTACTTAAATAAAGGTATAATATCGAAATTGACAAGGAAGAACTCTAATAAATAT
ATAATATTGTAGATAAAACTAAAGATAATGCATTAAATTACTTAGAATTTAAAGAATGTG
CTATCTCCTAAGATGCTAATGCCATTTTCTCTAAAATGATTTCTAAAGTACGTACTTAAG
AACAACAAAAAAAATCAGCAGAGGAAAGAAACATTTATTTACCTTAAAGATTCTCAGAAA
TGGTCACTTATCTTAGCTATAGAATTAATAGAGAGGATTTAGAAGATTATTTGAGAGAAA
GAAATCACAGAATCAGTGAGAGATACGAAAAATATTTATAATTAATGAATTTAAATGGGC
TTGATTCAGCTGGAGCAACTGCTCACGAAAACCAAATCAAAGATTAAAAAAAATTAGATA
AGGTAACAAAAAATTAATGAAAATATAAATGACAGATATTAACTAATTCACTCTTTAAAA
ATTTTATTAAATTGTTTTATCAATTAGAATGAATCTCTTGCTTTTAAAATTCAAAAATAT
TTACTTTACTTTTTTCGAACATTTAAAATATTAATGGGGGTATGTATTATTTATTATAAA
ATCATTTAATTATTATTTTTATAAAAAAAAAAATAAATTTCATTTTATCAAAAATAATAA
AATTTTAATTTCAATCCTCTACTAAAATAAGAAATTAATATTGAATTGTTTTAATATTTT
AAAAGGCTAGTGATCTTGAGTAGAAAATTTTTGATAGGCAATCTAGTTCAGATTCAGATG
GTGAATCTTTAGAAGCTGAAAAGTCTTTTAGAAATTAAATTAAAGAAGAGCAGTTAAAGA
AACAATAAAAAGCATAATATAGACTATCTTAGGCTACAAATTCAGTCAACAGATCATAAC
CTCATTTGATGTCTACTTCTCCTAGACATGGCTCACTTTAAATAGAACTTTAGGCGTAAA
ACAGTAATTATTTTTTGCAGTCTTCTGTAGCTGGTGCTTAAACTTATGGAACTTAAGGAA
GCAATTATAACAACTCAAACTCTTAGTTGGCAGCTTCTAGAGGTTCAATTAGGAACTCAA
AAATTAGAACATAAGGGAAAAAGGAAATGGATGAGGAGTAAATTCACAACAAATTTACCA
AATATGAAGCTTAGAGTCTATCTAAAAAGGCTCAGCTCAAAGGAAAGGATGATGCATAAA
ATTTATATACTGAAGTATCAAAATAATATGGTACACAAGAAAATTTTTACAAGACTTTCT
AAAGCACTTAAAATTGGTAGAACGCTAACAATGATACTTAAGCTGGTTTAAAAAATAAAA
CATAATTATAAACTGATGAGACTGATTCATAATTAGGTAGTGTAGAAAACAAAAAGTCTG
CTGAAAGAAGCAATTTATTACCTCTGTCAACAACATTTTAAAACCATAGAGGAGGAATAG
GGAAATTCTTTGGAAGTAATGGCTAAGACTTCGAGAGCACTTAGAATTCTTAAAATATAA
ACAATAATATTTACGGAACAAGATAAAAATATTCAAACGATGACTTTAGACATACTGATT
TCAAAGGATTTAATAATAAGAGTCATAATTAGCTAGGAACAATGAGGAGTGTCAGTTAAT
TTATGACCAGCAAGAATAAATTTAATAGCACTTTCTATACTCTTGGGAAGCGTCCTACAA
CAAATTAAAGCTAATTAAAAACTCTCGGGATAGATAAAAGCTCATTTAAAAGCATTTGCA
ATATAATGAATAAAACATTGTTGCAACTAGAGAATAAGAAAATTACAAACAATTTGTTTA
TAAAAACAGCTCCTTCGTCTACTAGATTTTCTTATAATAAGCAAAACTAGGAAAATAAAG
TATAGAATATGAGCTAAAAACTATTGAATTAGAATATAGAGAATAATATAATAGATCCGA
AACTAATGCAATCTATTTACAAACCTAACCAGATATAAGAATATTAAGAAAGAGAGAAAT
AATTGATAAATGAAATCAAACAAGATATTATGAATAAATTTTTAATGAACAATCAAGTTG
CTGTGTCATTATTTGAAGATTTACAAAAATCAAATTAAAAACCATATTATAAAGTTAATC
ATTCTATCACAACAGAACAATCATTCTTAAAATAAAACAGGCTTCCTGAATTAGATATGA
TGAATAAAGTGTACGAAAAAGATAAGACACCTATTGGTAAACACATGAATAATTAACTTG
ACAGCAAATATTTAAAAAATTGA