Identifiers and Description

Gene Model Identifier

TTHERM_00937640

Standard Name

None

Aliases

PreTt22823 | 169.m00063

Description

peptidase M16 inactive domain protein; Peptidase M16 inactive domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06331 ) REX1 DNA Repair
  • ( PF08367 ) Peptidase M16C associated
  • ( PF05193 ) peptidase M16 inactive domain
  • ( TIGR02955 ) TMAO reductase system periplasmic protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00937640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14064.19.997093137033517e-262peptidase M16 inactive domain-
containing protein (1060 aa)
OxytrichaContig17660.0.g1092.9991134817918505e-180Peptidase M16C associated
DictyBaseDDB_G02715061.0001900614163146e-108pitrm1 on chromosome: 2 positi
on 455398 to 458761
SGDYDR430C6.99980278126514e-75CYM1 Lysine-specific metallopr
otease of the mitochondrial in
termembrane space, member of t
he pitrilysin family; degrades
proteins and presequence pept
ides cleaved from imported pro
teins; required for normal mit
ochondrial morphology
Stentor CoeruleusSteCoe_45655.301718666092324e-65
WormBaseWBGene000154810.00000000009001903211590313Uncharacterized protein C05D11
.1 status:Confirmed UniPro
t:P48053 protein_id:CCD63190
.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00937640(coding)
ATGTTAAAGCGCGTAGTAAAATAGCAAATAAAATAGTTTAGGAAATCATTTTGCTTTGTT
CCTAATTACAGGAACACGGAGTTAGCAAGATTTTTCAATCCTGAGGACTCAGAGATTATT
GAAAAGCTCTTTAGAGGAAAACATAGAGTTTAGTATTCTCTCGAGAAGGGGCAAGTTGTT
AACAATTTCCATGTAGAAGAAATAACATTTTTAAAGGAATTCAACATTAGAGTATATGCT
TTGAGACACAAAGTGACTCAAGCTAGATATATTCATTTAGATTCATGCGATATGAATAAC
TCTTTTGCGATTATTCTGAGAACACCTCCAGAAAACGATAAAGGAATTCCATTGATGACT
TAGAGATTGGTGATGTCTGGAAGTGAAATGTATCCTGTTAAAGAAGTTCTTTCACACATG
GCAGAAAAAAGGTCAATGAACACATTTAGCGAGCCTTGGACAGGCCCTGAATTTACAGTT
TTTCCATTTTCTACAACAAACGAGAAAGATTTTTATAACCTGTTAGGCGTATACATTTAA
AGTGTATTCTATCCTCTGAATAGAAGATTAGACTTTTTGCAAGAAGGAGTTAGATTAGAA
TACGATGAAGAAAATAATCCAAAACTTCCAATCTCTTTAAGAGGAAAGACCTACGAGGAA
ATGTACAATAATGAATAGATGCATGATCACATTTTTCTCTCAAATATTTAAAAAAAGATA
TACAAAGGCAGTCATCATTCAAATTTAGGCAGTGGAACAGTTTAGCAAATCAGAAATGCA
TCTTATCAGGAAGTGATTGATTATTATGAAAAGTATTACAGTCCAAACAATGCAAATTTC
TTTTCTTATGGAGATTTGGATTTTACAAAGCACTTGGAGTTTATTGATTAAGTTTTGATG
AAAGGAAAGGAGTATAAAGAGATAGTTCATACTTTTAAATAGCCAGAGTAGATTTAATAT
ATTCAGGATAATGAGATTACTTGTCCTTCAAATAGTTAAGGATCGATTGGTATTACTTTT
ATGTGCAATGATATTATAGACAATCCCTTCGATACTCTCGCTTTGAGTGTATTAAGCTAC
TGTTTGTTTGAAATGCCTTAGTCCATTTTCTTCCAAGAATTCTTGCAAAGCGGAGTAGCC
AGTAAATATTGTCCTGGATACGGATACGACATTACAAATAGAATTGCTACTTTTACATTT
GGCTTTGCAGAAGTCTCCAATGACAAATCTGAATTAATTCAAATGGGAGATAAAATCATG
AAAATTTTGAAAGATATTTCTGAAAACGGGTTAGACGTTTAAATGGTTGATTTTGCTATT
CATTACATGGAAGTAAATGCTAAAGAGGGTAAGGCTGATTTTGGTCTGAATTTACTTTAG
AATATGATTCCATTTATTATACATGATAAGGATCCGACTGTTGTTTTGAAAATGGAAGAA
AGTTTTGAGAAACTACGCAGAAAAATTGACGAAGGGCTCATTTAGTAATTAGTTAAGAAG
TACTTCTTGAATAACAATCATGGAATAAGAACAATTGTTACTCCTGATAATCTTTTTACT
GATTACGTTAAAATAGAGGAAACAGAATACCTCAAATCAGTGCAAGAAAGTATGACAATT
CAAGACATTGATTTCTTGCAAAAAGAAAATGAGCAAGTTTTTGTTGAAATGTGCAAAATG
CAAGATGTTTCTATATTGCCATCACTAAACACTACTGACATAGTCCCTTTAGTTGAAAAG
TTCGACTATGAAGAACAAGTAATAAACGGAATTAACGTGTGGTTTACTGACTAAGAAACA
AATGGAATGTCATACGTAAGAATTAAATTTGATATATCCGATTTAGAACCTGAATTGCAT
CATTTTTTGGAGCTCTTTTGCATCGTCTTCCCTCACATAGGCTCACAAGGACTTCAAACT
AATTAAATGGACTTTTTAATTGATAACTACACTTCCAAATTCGAAATGGAGTCTCACATC
TTCAGAGATGTTAAGGGCAAAGATCAAATTAAAAAAGTATTGGTAATGACTGTGGGATAC
CTTGATAAATATATTGAATAGAGTTTTAGTCTTTTGAATGATTTACTTTCTACTCCCAAT
TTAAAAAATCTATCAAGAATTTCTGAATTGTTGTAATATTATGCTGGTATTTATGCCAAC
AATCTTGGAGAAAAGCCTATGGACATCGCAATCGCTCATGCTAATTCAGGTCTAAGCAGG
GCTCTCTTTTTAAATGATAAAATGAAAAAAACGTAAGACATTTGTAGTTTGGCTATTGAA
GTCCTCAAAACAACTTCTCTAAAGCAAGAGTTAGAAAAAATTTCTTATTACTTAGAATGC
ATTTACCAAAAAATGATTAATAAAAACAGAATGAGCATTTTAATTCACAGCTAAAAAAAG
AACTACAAAAACTTATAAAAAAGAATTGAATTGCTATCATCCACTATAAAAATCAATCAA
CCAAATTTCAATAAATCAATTATCATTGAGAGCGAAAAAATGTAAGAATTCAAGGAGAAA
TACAACAGATCATTCATTCCTTTGCCTATTAATACTAATTACATTGTGGAATCTTTTAAA
ATGCCAGAAGTTATTGATGGAAAGACTCCTGTTATGCATTTAGTAGGTGAAATTATGAGA
AATTGTATTCATTTTGAAGAAATTAGAAGTGTTGACGGTGTTTTTGATGCTGGCTGTTAC
ATAGATTTGAATGGTAGTTTCTCAGTCTTTTCTTATAGAGATCATAGCACTGTTTAAAGA
TATGAAACATTCGAAAGAGCAATTCAATATATTACAAATAAAGACTTTACAGAAAGAGAA
TTGAAAGAAGCTAAAATCAGTTTGTTCTCCAAGATTGATAAAAACATTGAGCCTTATAAT
AAAGGAATTAAGTGGTTTATTTATGGATTAAATGATAGACTCAGATTAAATTATCGTTAA
GCTCTCTTAGCGGCCAACTCATAAAAAGTAATTGACACTGCTAATGAGATTCTTCTTGAA
AACATTAAGAAAGAACAATCAAGCCAAGTTATTATTGGATCTCAAGCACACAATCTTAAA
AAATTACTTTCAAGAGGCTGGAAAATAGAAAAAGCTGTTGATGGTATTTCTGTGTCACCT
AAATCATATAGATAAAACGAGAATCAATAATATGTTTATAATGAGTTTATGTGA


>TTHERM_00937640(protein)
MLKRVVKQQIKQFRKSFCFVPNYRNTELARFFNPEDSEIIEKLFRGKHRVQYSLEKGQVV
NNFHVEEITFLKEFNIRVYALRHKVTQARYIHLDSCDMNNSFAIILRTPPENDKGIPLMT
QRLVMSGSEMYPVKEVLSHMAEKRSMNTFSEPWTGPEFTVFPFSTTNEKDFYNLLGVYIQ
SVFYPLNRRLDFLQEGVRLEYDEENNPKLPISLRGKTYEEMYNNEQMHDHIFLSNIQKKI
YKGSHHSNLGSGTVQQIRNASYQEVIDYYEKYYSPNNANFFSYGDLDFTKHLEFIDQVLM
KGKEYKEIVHTFKQPEQIQYIQDNEITCPSNSQGSIGITFMCNDIIDNPFDTLALSVLSY
CLFEMPQSIFFQEFLQSGVASKYCPGYGYDITNRIATFTFGFAEVSNDKSELIQMGDKIM
KILKDISENGLDVQMVDFAIHYMEVNAKEGKADFGLNLLQNMIPFIIHDKDPTVVLKMEE
SFEKLRRKIDEGLIQQLVKKYFLNNNHGIRTIVTPDNLFTDYVKIEETEYLKSVQESMTI
QDIDFLQKENEQVFVEMCKMQDVSILPSLNTTDIVPLVEKFDYEEQVINGINVWFTDQET
NGMSYVRIKFDISDLEPELHHFLELFCIVFPHIGSQGLQTNQMDFLIDNYTSKFEMESHI
FRDVKGKDQIKKVLVMTVGYLDKYIEQSFSLLNDLLSTPNLKNLSRISELLQYYAGIYAN
NLGEKPMDIAIAHANSGLSRALFLNDKMKKTQDICSLAIEVLKTTSLKQELEKISYYLEC
IYQKMINKNRMSILIHSQKKNYKNLQKRIELLSSTIKINQPNFNKSIIIESEKMQEFKEK
YNRSFIPLPINTNYIVESFKMPEVIDGKTPVMHLVGEIMRNCIHFEEIRSVDGVFDAGCY
IDLNGSFSVFSYRDHSTVQRYETFERAIQYITNKDFTERELKEAKISLFSKIDKNIEPYN
KGIKWFIYGLNDRLRLNYRQALLAANSQKVIDTANEILLENIKKEQSSQVIIGSQAHNLK
KLLSRGWKIEKAVDGISVSPKSYRQNENQQYVYNEFM


>TTHERM_00937640(gene)
ATGTTAAAGCGCGTAGTAAAATAGCAAATAAAATAGTTTAGGAAATCATTTTGCTTTGTT
CCTAATTACAGGAACACGGAGTTAGCAAGATTTTTCAATCCTGAGGACTCAGAGATTATT
GAAAAGCTCTTTAGAGGAAAACATAGAGTTTAGTATTCTCTCGAGAAGGGGCAAGTTGTT
AACAATTTCCATGTAGAAGAAATAACATTTTTAAAGGAATTCAACATTAGAGTATATGCT
TTGAGACACAAAGTGACTCAAGCTAGATATATTCATTTAGATTCATGCGATATGAATAAC
TCTTTTGCGATTATTCTGAGAACACCTCCAGAAAACGATAAAGGTAGAAAGTAGTAATTA
AGATTTAATTAGAATAAATTCGTTGATAAAATGAGCAAAAGCATGCTTTAAATAGAAGAT
CTATTTTAAGGAAGGAGTTTAGCATTGAAGATGGATAGAAAAGCGAATTTAATTTTACTT
TATAATAGAATTTAGATTTGTTTTAGATGATTTTTTGTGTTTTTTTAAATAGGAATTCCA
TTGATGACTTAGAGATTGGTGATGTCTGGAAGTGAAATGTATCCTGTTAAAGAAGTTCTT
TCACACATGGCAGAAAAAAGGTCAATGAACACATTTAGCGAGCCTTGGACAGGCCCTGAA
TTTACAGTTTTTCCATTTTCTACAACAAACGAGAAAGATTTTTATAACCTGTTAGGCGTA
TACATTTAAAGTGTATTCTATCCTCTGAATAGAAGATTAGACTTTTTGCAAGAAGGAGTT
AGATTAGAATACGATGAAGAAAATAATCCAAAACTTCCAATCTCTTTAAGAGGAAAGACC
TACGAGGAAATGTACAATAATGAATAGATGCATGATCACATTTTTCTCTCAAATATTTAA
AAAAAGATATACAAAGGCAGTCATCATTCAAATTTAGGCAGTGGAACAGTTTAGCAAATC
AGAAATGTAACAAAATTTTAATTCTAAAATTAGAAAAAATATTTTATTTTATTAAATAAA
ATTTTAATTTGAGAGAAGAATTTTCATTTTATTTTTAGTTTTTCTTAAGAAATAATTTTG
GTTTGATTTTGAATAAGAAATAATTGGAATAATTTAGGCATCTTATCAGGAAGTGATTGA
TTATTATGAAAAGTATTACAGTCCAAACAATGCAAATTTCTTTTCTTATGGAGATTTGGA
TTTTACAAAGCACTTGGAGTTTATTGATTAAGTTTTGATGAAAGGAAAGGAGTATAAAGA
GATAGTTCATACTTTTAAATAGCCAGAGTAGATTTAATATATTCAGGATAATGAGATTAC
TTGTCCTTCAAATAGTTAAGGATCGATTGGTATTACTTTTATGTGCAATGATATTATAGA
CAATCCCTTCGATACTCTCGCTTTGAGTGTATTAAGCTACTGTTTGTTTGAAATGCCTTA
GTCCATTTTCTTCCAAGAATTCTTGCAAAGCGGAGTAGCCAGTAAATATTGTCCTGGATA
CGGATACGACATTACAAATAGAATTGCTACTTTTACATTTGGCTTTGCAGAAGTCTCCAA
TGACAAATCTGAATTAATTCAAATGGGAGATAAAATCATGAAAATTTTGAAAGATATTTC
TGAAAACGGGTTAGAGTAAAAACTAAAATTTTATTTTTTTAAATAAGCATTGAAAATTTA
TGAATTAATTTTATTTCATTTTGTGAAAATTCAGTTTAAAAATTGATAAAAAGTGGAAAA
ATAATTTTAATTCTAAATGAAAATAATAAAATAGCGTTTAAATGGTTGATTTTGCTATTC
ATTACATGGAAGTAAATGCTAAAGAGGGTAAGGCTGATTTTGGTCTGAATTTACTTTAGA
ATATGATTCCATTTATTATACATGATAAGGATCCGACTGTTGTTTTGAAAATGGAAGAAA
GTTTTGAGAAACTACGCAGAAAAATTGACGAAGGGCTCATTTAGTAATTAGTTAAGAAGT
ACTTCTTGAATAACAATCATGGAATAAGAACAATTGTTACTCCTGATAATCTTTTTACTG
ATTACGTTAAAATAGAGGAAACAGAATACCTCAAATCAGTGCAAGAAAGTATGACAATTC
AAGACATTGATTTCTTGCAAAAAGAAGTAAAGATTTCCTTTTAAATAAATTTTACTAAAT
GAAACTATTAAAATTAGAATGAGCAAGTTTTTGTTGAAATGTGCAAAATGCAAGATGTTT
CTATATTGCCATCACTAAACACTACTGACATAGTCCCTTTAGTTGAAAAGTTCGACTATG
AAGAACAAGTAATAAACGGAATTAACGTGTGGTTTACTGACTAAGAAACAAATGGAATGT
CATACGTAAGAATTAAATTTGATATATCCGATTTAGAACCTGAATTGCATCATTTTTTGG
AGCTCTTTTGCATCGTCTTCCCTCACATAGGCTCACAAGGACTTCAAACTAATTAAATGG
ACTTTTTAATTGATAACTACACTTCCAAATTCGAAATGGAGTCTCACATCTTCAGGTACT
AAAACAAAATTCTTAAAATAAATAAATAAATAAATAATTTTAATAAGATTTATAAAATAT
TTCTTTTAAAAATTCATTTAAGAAATTGCAAATTTTATATAAACAATTTATAAAATAAAA
AGAGATGTTAAGGGCAAAGATCAAATTAAAAAAGTATTGGTAATGACTGTGGGATACCTT
GATAAATATATTGAATAGAGTTTTAGTCTTTTGAATGATTTACTTTCTAGTAAAGATTTA
ATTTTGAAAAATAAATTGTTTTTATTAATAATTTGATATAAAAAAGCTCCCAATTTAAAA
AATCTATCAAGAATTTCTGAATTGTTGTAATATTATGCTGGTATTTATGCCAACAATCTT
GGAGAAAAGCCTATGGACATCGCAATCGCTCATGCTAATTCAGGTCTAAGCAGGGCTCTC
TTTTTAAATGATAAAATGAAAAAAACGTAAGACATTTGTAGTTTGGCTATTGAAGTCCTC
AAAACAACTTCTCTAAAGCAAGAGTTAGAAAAAATTTCTTATTACTTAGAATGCATTTAC
CAAAAAATGATTAATAAAGTAAAATAATTTTCTAACAAAAAAATAAAAATAAATAAATCA
AATAATTTGTTAAATTTACAGAACAGAATGAGCATTTTAATTCACAGCTAAAAAAAGAAC
TACAAAAACTTATAAAAAAGAATTGAATTGCTATCATCCACTATAAAAATCAATCAACCA
AGTAAATTTTGTTTTATTTTGATTGTATAAAAATGGCTTATTTATTAATAAATTTCATTC
TAATCTTTAAATTGAGCAGATTTTTAATGTTTTTTACTTGATAATTTTAAAGATTTCAAT
AAATCAATTATCATTGAGAGCGAAAAAATGTAAGAATTCAAGGAGAAATACAACAGATCA
TTCATTCCTTTGCCTATTAATACTAATTACATTGTGGAATCTTTTAAAATGCCAGAAGTT
ATTGATGGAAAGACTCCTGTTATGCATTTAGTAGGTGAAATTATGAGAAATTGTATTCAT
TTTGAAGAAATTAGAAGTGTTGACGGTGTTTTTGATGCTGGCTGTTACATAGATTTGAAT
GGTAGTTTCTCAGTCTTTTCTTATAGAGATCATAGCACTGTTTAAAGATATGAAACATTC
GAAAGAGCAATTCAATATATTACAAATAAAGACTTTACGTAAAAAAAATTTATCTTACTT
AATCTTGTTAAAAATTTTATGAATGAATTAATGAATTATTTTTATTTAGAGAAAGAGAAT
TGAAAGAAGCTAAAATCAGTTTGTTCTCCAAGATTGATAAAAACATTGAGCCTTATAATA
AAGGAATTAAGTGGTTTATTTATGGATTAAATGATAGACTCAGATTAAATTATCGTTAAG
CTCTCTTAGCGGCCAACTCATAAGTAAATTATTTATATTTTAAATGTTTTTTTTAATTAC
TTTAATATTTACAGAAAGTAATTGACACTGCTAATGAGATTCTTCTTGAAAACATTAAGA
AAGAACAATCAAGCCAAGTTATTATTGGATCTCAAGCACACAATCTTAAAAAATTACTTT
CAAGAGGTAAAATTTACATTAATTTTTATTCGTTTATTTGCATTTTTGAATTGTTATTTT
TTAATTAAATTGTTTTAAATTATCTTTAATTATAATAAATTGTTTTATTTCATTCAAATT
ATCTTTAAAAAATAAATAAATTGTTTTGATTTAAATTCTAAATTATTTTAAACGAAAGGC
TGGAAAATAGAAAAAGCTGTTGATGGTATTTCTGTGTCACCTAAATCATATAGATAAAAC
GAGAATCAATAATATGTTTATAATGAGTTTATGTGA