Identifiers and Description

Gene Model Identifier

TTHERM_00926910

Standard Name

None

Aliases

PreTt15246 | 166.m00053

Description

Protein kinase domain containing protein. Sequence similarity to the Aurora protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF04259 ) Small, acid-soluble spore protein, gamma-type

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00926910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03139.19.997093137033517e-262protein kinase domain-containi
ng protein (1614 aa)
OxytrichaContig12227.0.g76.001435805040647e-94Protein kinase domain
DictyBaseDDB_G02793434.0006908853687255e-76aurK on chromosome: 3 position
1959552 to 1961164
WormBaseWBGene000000996.99980278126514e-75locus:air-2 Aurora/IPL1-rela
ted protein kinase 2 status:
Confirmed UniProt:O01427 p
rotein_id:CCD61317.1
SGDYPL209C1.9997677415930956e-65IPL1 Aurora kinase subunit of
the conserved chromosomal pass
enger complex (CPC; Ipl1p-Sli1
5p-Bir1p-Nbl1p), involved in r
egulating kinetochore-microtub
ule attachments; helps maintai
n condensed chromosomes during
anaphase and early telophase
Stentor CoeruleusSteCoe_177125.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00926910(coding)
ATGATGATTGACAGCAGCTCTTCTTCGAGCAAATCTAAACTTGAATTAAAATTGATTGGT
CCATAATCTTCTCGTAATTAATTACGTCAATCAAATAATATGACTAATGGAAATTTATCT
ACTAATAGCCAAATGGGCTTTAATACTACTTGCAATACAGCACGTAACTAATAAAATGTA
ACTCCAAAGCGCTAAAATAGCAATCATAATGGGAATAGTGTAAACTAGGCATCTAATTTT
AATATAAATTAGAATAATATGAATGCTTGCAATACTGCAAGCAGTAATTATAGCAGCTTA
TTGAATGGTACTCCAAGCTCTCTAAATACTCAAATGAACAATCGTATGTAAGGAAACAGT
TACTTAAATAAGACAAGCAACAATGGTAGCTCAGTTAGTAAGCTTAGTAATTAGAATTTT
TCTAAAAAGAGTGGATCTGGACTTGGCTCTAATTTAGGCTCTACGAAAAGCTATTAAAAT
AATCAAAACCATCATTCAGGAAGCATTGTGGGAAATTATACTGGTTCTAGCTTAAATCAG
AACCAAGGAAGTACATTTAGTAAAGAAAAAATGAATACTGTTATGAAAAATAATATGAGT
AAATAAAAAACAAATTCAAATATGCATATGACTCACAAAAACTAAATACTTTAGCAGTAT
TAAGCTAGTTAATAGCAATTTATATAGTAGCAGCTATAATAGCTCAGCTATGCAAACAAT
CAGCAATCACACTCTTAACTTAACTAACTGATGGATTAATCTCCTAATTAGACATATCAT
TTGTCTCCTTCTACATCATAATAGCAGATAAATACCAATGAAAATACCAAAGTAAAAAGC
TCATATCTTTCATCTAAGCCTACAAGCCCACATTCCTACTTAGGAAATTCAGATACCTAG
GGTAATTCTAAAAATTTCCAAAAGTTTTCTCAGCCAAGCAACATTAAAGAATCAGGTTAT
TTCAGCAATCCGTTTGGTCAGAGTTTGTCAAGCACAAATAACTCTAAATCAAATAAGTGT
ATGACTCCTATAAATGAGAAAAGCAGTAAGAGTCAAAATAGCTATTTAAAGAAGTCATAA
CTCATCGTTACTTCAAAGAATCAAAACAGCTCCAACATGCTGAATACTTCAACAAACAAC
AGTAATACTTCATTTTTGAAATAGAGCCATTCTCGTTCACCTTTGAGCTCTAATCATATT
GAAAAAGAAAATAACTATCTTAGCCACTTTGATTCCTCTAGCTTGTATATCAATGAAAAA
TCAAAAAGAATGTCTTAAGCGTAGCAGTAAAGCTAGTCATAATCTCATTTACAATAATCC
CCATTTTCTTACTTATCTTCAGGCCATGCTTCCTCTATAAACAACCAAGGAAATACTCAA
AATACCTCCCACTTGAATAACTTATCAGGTATGAGCAAATCTAAGTCAAGCAAAAGTCCA
AAGTAATCTAATTCTCTTTAAATGGTAACTTAATCTCTAGAAACTCCTGCTGGAAACTTT
TTTTCTTCTCATTTGAGTAGAAAAAAGAATCTCAGCACTGTTAACTACAACAGCTTTACA
TAAAATATAGAAAAATAATCTTCTTCTTCGTCTTCCTAATAGAATTAATAGTAATCATAT
ACTATGAGCACCCAACACAACTTTGATTCATCTCCAATCAGCAATACCAGAAGAATGAAT
TAATTCAACAAAAACGAAAGCTCTGAAATGCTTCAATCTAATGGCTAAAATTCCTTCTTG
CTTTCATCTAATTTAAAAGATAATAATTAAGAACTTATTTAAAACAAGACTCATGATTAT
GGTTCATATAATAACAATAAAAACAGTGGATTTTTAAGCCATTATCCTAATAGCAGCAGA
TTCGATTAATATCGTAGTGTTGATGGCTGCTCTGAAGGATAAAATAACAGGAATTTCTTC
CCAAAGACATATTTAAATATTGAAACCAAAGATTCTTATGTAAGCTTGAAAAAGAAGAAC
ATCACTATGGGTGGAGAGATGCTTAACGGAATAGGATAAAATAAATCAAGTAACGGAATA
TTAACAACCGATAATAACTTTATTACACTAAATGAGCAAGAGCTTAGTTTCTAAAACGAT
TAAGAAGATAACATCATGATGATGATTAACTAATAAAATCATAACTAAACTAACATTTAG
CCTGGCAATAGCTACTGCTATGGCTACTACAATGAAGATGAAAGTAATTTCTTAAATAGC
ACAAACTTCCTTAACTTAACAAATCTCCAAATAAACACATAAAACAACACGATGATAGCT
ATGAGCAATAATTACAATAATAATAATAAAGATGTCAATAACTATCCAAATAAAAACTCA
TCTACAAACGGTAGTTAAGTACTTCAACAAAATTACAATGGCACCAACACTAATAATAAC
ATTTACTAACAATATAATATGGGTAATAATAACAACAATGATAATATTGGTAATGCTAAC
TTATCAATGTAGTAAAATAACTTAAGTAATACTTTGAATTGGACTAATAGTACTAACTTA
TTTAATAACTCAGTGTGTGCTGGTAGTATGTTGAATACAACTATAAATAACATCCTTTAA
AATATGAATTCAACCCAATCAACTAACAACACCTTAAGCGGCAATCCTAATTTTTTAAAT
TCTAATAACCCAAACAGTAATGCTAAGGCTGCACCAAATATTTATAGCAGCTTGTCTTAG
TAGAATTCAAATACTAATCCAACAAACACTAATGCTAATAACACTCCTACAAACACTAAC
AACAATAACTAAGGAAATAGCTTTTCATAAGCAGTTATAAATAATATATCTATTCCTGCA
AATGGTCAGACTGACAAGCTTCCACTTGACACAACACCAAAATAAGTTTCGTTATTCCCT
GAGCCAATCCCGAATAAAAACTAATGCAGCAGCTTAAAGAGCATTCTATATGATTACGTA
ATGCCAACAATAAAACCTATAACTCGCCAGTTTAAGTTACTGAGTAGCCATCAACAAAAC
AATTCTCAGAGCAACTTTTAGCAAAGCATAAACTTAAATACAAATAATATCTTTGGAAAT
GAAAGTCTTAGCAACTAAAATAAGTAATAAATTTTAAGTTCTCTTAATAAATAGCTAAGC
AGCAAAAATTTAAGCAACAATGCTTCAGCAGCAAATCTAAATTCAAGTAGCAATAATATC
AATAACACAAGCAGTATTGTTGAGAACAATAACTGTTTAGTTAATAGCAGCTGCAACATG
AATAATTTTAATAATTTTAAGAATCCCTTTAACTTTGATGATTAAAAGAGTGAAAATTAC
TCTTGCTCTCAAGGTTTCCCAAGCAGCAACTTCTTAGATTTAAAAGAATAGCAGCAAACT
CAACAAAGTCAATAACAAATTTATTAATAACTAGGAGAGTCTCAAAATAGCAACTAGGCA
ACTCCTATTAAAATACATTTAAAAGTAGATAGCCAATCAGTAAACTCATTCAATAAGAAC
AATCTATTTTCTTAAAATCAGGGAACACCTGCAATGAAATCTCCTTCTAACAAAGATGAT
AATATTTATTACCAAAACTAAGGTACTCCATAAATGAAATCACCAACAAACAAATAAGAA
ATCAGTTCCTCGAATCATTAACTCACCCCATCTTCTTAGGGTAATGGTGGAAAATTAACT
TTTTGTAATAATCCTACAATTATCATTTCTTCTGAGAAAGATTAACTTACAATGTAGTAA
TACAATTTCTCTTTCTCCAACTGTGTAAACTAACAAAAAAAAATACAATAGTAATAACAA
TAAGCTTAAGAATAGTAAGAATAAAAATAATAGAGTCAAAATACTCTTCATCCTAATTAA
ATCTTTTCTTCTCCTTAAAAGAATTTAAAGAAAGATGATGAGAAAAAGAAAGGAAGCAGT
TAGAAAAAAGGCAATTTATTAATAAATCAAGAGCACAGACTCGTAGAATCCTCTAAGCAA
GAATACTCAACCTCCCCTGAAAAACCTGTGATTAATATTCTTCTGTCTCAATAAATCACT
GTTGTTGATGGAATATCATAAGTCTCATCTCAAATGTTCAACATTGAATAACCAGATCCC
TTTGTGGACTAAAGCCTTATATAAAATTTTTGGTCGATCGATTCGTTCTAAATTGGAAAA
TGTTTAGGTAGAGGAAGATTTGGTAATGTCTACTTAAGCAGACATAAGCTTACAAATATG
CTCTTTGCAATTAAGCAAATAAGCAAGAAGAATTTGATAGAAAGCTGCATGGAAAAATAA
CTCCAACAAGAAATTAAAATTTAGACTTATTTAAATCACCCAAATGTTTTGAAAATGCAC
GGCTTCTTCGATGATAGTTAAAAAATATATCTAATTCTTGAGCTTGCTTCTCATGGAGAT
ATTTATAAAGAAATAAAAAGAGAGGCAAACAAGAAATTTACCGAAGAAAAGGCAGCAAAT
TATATTAGACAAGTGTGTGAAGGATTAATTTATTTACATAGTTAAGGTATCATACATAGA
GATATAAAACCTGAAAATATATTGAATAGCTACGGAGTCCTTAAATTAAGTGATTTTGGC
TGGTCAATCTATACAGAAGAAAAAAGAATGACTTTTTGTGGTACACTCGATTACGTATCT
CCAGAAGTTGTTTCAGGAAAAGACTATGACTTCAAGGTAGATATTTGGAGCATTGGAGTA
CTAACATATGAATTAATCACTGGTAAACCACCATTTGAGAACAGACAAAACCATAATGAA
GCCTACTAAAAGATTTTAATGGTTAAGTATGATTTTCCTAACTACATTAGCAAAGAAGCC
AAAGATTTTATGAGTAAACTGCTGGTTGGAGACCCGAATAAGAGAATATCTTTAGAAACT
GCTTTAAACCATGAATGGATCTTAAAAAATACTAGAAACTGCTTAGCTGACTGGGATCCT
AAAGTGAGTGAAGCTTGTTTATGTTTACTTAAATGA


>TTHERM_00926910(protein)
MMIDSSSSSSKSKLELKLIGPQSSRNQLRQSNNMTNGNLSTNSQMGFNTTCNTARNQQNV
TPKRQNSNHNGNSVNQASNFNINQNNMNACNTASSNYSSLLNGTPSSLNTQMNNRMQGNS
YLNKTSNNGSSVSKLSNQNFSKKSGSGLGSNLGSTKSYQNNQNHHSGSIVGNYTGSSLNQ
NQGSTFSKEKMNTVMKNNMSKQKTNSNMHMTHKNQILQQYQASQQQFIQQQLQQLSYANN
QQSHSQLNQLMDQSPNQTYHLSPSTSQQQINTNENTKVKSSYLSSKPTSPHSYLGNSDTQ
GNSKNFQKFSQPSNIKESGYFSNPFGQSLSSTNNSKSNKCMTPINEKSSKSQNSYLKKSQ
LIVTSKNQNSSNMLNTSTNNSNTSFLKQSHSRSPLSSNHIEKENNYLSHFDSSSLYINEK
SKRMSQAQQQSQSQSHLQQSPFSYLSSGHASSINNQGNTQNTSHLNNLSGMSKSKSSKSP
KQSNSLQMVTQSLETPAGNFFSSHLSRKKNLSTVNYNSFTQNIEKQSSSSSSQQNQQQSY
TMSTQHNFDSSPISNTRRMNQFNKNESSEMLQSNGQNSFLLSSNLKDNNQELIQNKTHDY
GSYNNNKNSGFLSHYPNSSRFDQYRSVDGCSEGQNNRNFFPKTYLNIETKDSYVSLKKKN
ITMGGEMLNGIGQNKSSNGILTTDNNFITLNEQELSFQNDQEDNIMMMINQQNHNQTNIQ
PGNSYCYGYYNEDESNFLNSTNFLNLTNLQINTQNNTMIAMSNNYNNNNKDVNNYPNKNS
STNGSQVLQQNYNGTNTNNNIYQQYNMGNNNNNDNIGNANLSMQQNNLSNTLNWTNSTNL
FNNSVCAGSMLNTTINNILQNMNSTQSTNNTLSGNPNFLNSNNPNSNAKAAPNIYSSLSQ
QNSNTNPTNTNANNTPTNTNNNNQGNSFSQAVINNISIPANGQTDKLPLDTTPKQVSLFP
EPIPNKNQCSSLKSILYDYVMPTIKPITRQFKLLSSHQQNNSQSNFQQSINLNTNNIFGN
ESLSNQNKQQILSSLNKQLSSKNLSNNASAANLNSSSNNINNTSSIVENNNCLVNSSCNM
NNFNNFKNPFNFDDQKSENYSCSQGFPSSNFLDLKEQQQTQQSQQQIYQQLGESQNSNQA
TPIKIHLKVDSQSVNSFNKNNLFSQNQGTPAMKSPSNKDDNIYYQNQGTPQMKSPTNKQE
ISSSNHQLTPSSQGNGGKLTFCNNPTIIISSEKDQLTMQQYNFSFSNCVNQQKKIQQQQQ
QAQEQQEQKQQSQNTLHPNQIFSSPQKNLKKDDEKKKGSSQKKGNLLINQEHRLVESSKQ
EYSTSPEKPVINILLSQQITVVDGISQVSSQMFNIEQPDPFVDQSLIQNFWSIDSFQIGK
CLGRGRFGNVYLSRHKLTNMLFAIKQISKKNLIESCMEKQLQQEIKIQTYLNHPNVLKMH
GFFDDSQKIYLILELASHGDIYKEIKREANKKFTEEKAANYIRQVCEGLIYLHSQGIIHR
DIKPENILNSYGVLKLSDFGWSIYTEEKRMTFCGTLDYVSPEVVSGKDYDFKVDIWSIGV
LTYELITGKPPFENRQNHNEAYQKILMVKYDFPNYISKEAKDFMSKLLVGDPNKRISLET
ALNHEWILKNTRNCLADWDPKVSEACLCLLK


>TTHERM_00926910(gene)
ATGATGATTGACAGCAGCTCTTCTTCGAGCAAATCTAAACTTGAATTAAAATTGATTGGT
CCATAATCTTCTCGTAATTAATTACGTCAATCAAATAATATGACTAATGGAAATTTATCT
ACTAATAGCCAAATGGGCTTTAATACTACTTGCAATACAGCACGTAACTAATAAAATGTA
ACTCCAAAGCGCTAAAATAGCAATCATAATGGGAATAGTGTAAACTAGGCATCTAATTTT
AATATAAATTAGAATAATATGAATGCTTGCAATACTGCAAGCAGTAATTATAGCAGCTTA
TTGAATGGTACTCCAAGCTCTCTAAATACTCAAATGAACAATCGTATGTAAGGAAACAGT
TACTTAAATAAGACAAGCAACAATGGTAGCTCAGTTAGTAAGCTTAGTAATTAGAATTTT
TCTAAAAAGAGTGGATCTGGACTTGGCTCTAATTTAGGCTCTACGAAAAGCTATTAAAAT
AATCAAAACCATCATTCAGGAAGCATTGTGGGAAATTATACTGGTTCTAGCTTAAATCAG
AACCAAGGAAGTACATTTAGTAAAGAAAAAATGAATACTGTTATGAAAAATAATATGAGT
AAATAAAAAACAAATTCAAATATGCATATGACTCACAAAAACTAAATACTTTAGCAGTAT
TAAGCTAGTTAATAGCAATTTATATAGTAGCAGCTATAATAGCTCAGCTATGCAAACAAT
CAGCAATCACACTCTTAACTTAACTAACTGATGGATTAATCTCCTAATTAGACATATCAT
TTGTCTCCTTCTACATCATAATAGCAGATAAATACCAATGAAAATACCAAAGTAAAAAGC
TCATATCTTTCATCTAAGCCTACAAGCCCACATTCCTACTTAGGAAATTCAGATACCTAG
GGTAATTCTAAAAGTAAACAAATCATTTATTTAAGTTTAATTATCTCTTTTGTGTTAAAC
TACTTATAAGTAACGTTAAATATCCTATAAAACTAGATTTCCAAAAGTTTTCTCAGCCAA
GCAACATTAAAGAATCAGGTTATTTCAGCAATCCGTTTGGTCAGAGTTTGTCAAGCACAA
ATAACTCTAAATCAAATAAGTAAGGATATATAAATAAATATTTAGATTAGTATAAATGTA
AAGGAACATTTGGAATCTAATAAGCATTTTTAAATTGAATTTAGATTTATTGATTGAATT
AATGAATGTCTTTGTGCATCATAAATTTCTTTAACATATTTTTTTTAAATAACCAATTTA
AATTATTAATTTATTGGTTATCAAAATTCAAGTTAAAATTTAGGTACTTTGTAATTAATT
TTCATTTAAAAACGATAGAAAATGAGTAGTGCTCTTTTTAATAAATAAGAAATTATAATT
AATTATTTCTATGGTTGATTTGTGATAAAGGAGATTTTTTCTAAACTTAAAAATCATAAA
TCATGCAATGAATATTAATTTATTTAGCTGTTTATTTTCTATCGAAACAAGAATAATTTC
ATTTCTGAAAGACTTTTAAATAAAGCAAAAAACACAAAATATTATAAGAAAGTATTATAA
TGTTAAGATAATAGCAGCTGCTTAATTATAATTAGTAAATATATTTTTGAATACTGGCTG
ATTGAGTGATTGATTTAAAAAAGAGAAAGAAGATTCGTTTTCACTTCGGGAAAGAATTTG
AAATAAGTATAACTCTCTATAAATTTAAATCTTTAGTTGTTTCTCACACTCGCTCCTTAT
AGATTAACAAATAAAAAATCAATAAATAAATCAGTCTCTTACCCAAACAAAAAAGATTAA
ATTTTTTGATAAAAAGAAAGCAACTTAAATAAAACTAATCTAAAAAATGATATAAATATT
CATTGAATTTAAAAATAATTAAGAGAATTAAAATTAAATTTATTAGAATGACTTTTAATC
TTTAATTTTAAGGATTTTTAAAATTAATAAAAAATATCTTTGAATTTTATTTTTCTGGCT
TTTTATTTTATTATTCATAAATTTTTATTTCTCATAGAAAATCGAACAATCTACTCTAAT
TTTTTAAAAATTTTCCATGCTAATTAAACAAAATTCCTTTTAAAAATTAAATTGATTCTT
AATTATGGTTGTATTTTTATAAATATGAAGGTGTATGACTCCTATAAATGAGAAAAGCAG
TAAGAGTCAAAATAGCTATTTAAAGAAGTCATAACTCATCGTTACTTCAAAGAATCAAAA
CAGCTCCAACATGCTGAATACTTCAACAAACAACAGTAATACTTCATTTTTGAAATAGAG
CCATTCTCGTTCACCTTTGAGCTCTAATCATATTGAAAAAGAAAATAACTATCTTAGCCA
CTTTGATTCCTCTAGCTTGTATATCAATGAAAAATCAAAAAGAATGTCTTAAGCGTAGCA
GTAAAGCTAGTCATAATCTCATTTACAATAATCCCCATTTTCTTACTTATCTTCAGGCCA
TGCTTCCTCTATAAACAACCAAGGAAATACTCAAAATACCTCCCACTTGAATAACTTATC
AGGTATGAGCAAATCTAAGTCAAGCAAAAGTCCAAAGTAATCTAATTCTCTTTAAATGGT
AACTTAATCTCTAGAAACTCCTGCTGGAAACTTTTTTTCTTCTCATTTGAGTAGAAAAAA
GAATCTCAGCACTGTTAACTACAACAGCTTTACATAAAATATAGAAAAATAATCTTCTTC
TTCGTCTTCCTAATAGAATTAATAGTAATCATATACTATGAGCACCCAACACAACTTTGA
TTCATCTCCAATCAGCAATACCAGAAGAATGAATTAATTCAACAAAAACGAAAGCTCTGA
AATGCTTCAATCTAATGGCTAAAATTCCTTCTTGCTTTCATCTAATTTAAAAGATAATAA
TTAAGAACTTATTTAAAACAAGACTCATGATTATGGTTCATATAATAACAATAAAAACAG
TGGATTTTTAAGCCATTATCCTAATAGCAGCAGATTCGATTAATATCGTAGTGTTGATGG
CTGCTCTGAAGGATAAAATAACAGGAATTTCTTCCCAAAGACATATTTAAATATTGAAAC
CAAAGATTCTTATGTAAGCTTGAAAAAGAAGAACATCACTATGGGTGGAGAGATGCTTAA
CGGAATAGGATAAAATAAATCAAGTAACGGAATATTAACAACCGATAATAACTTTATTAC
ACTAAATGAGCAAGAGCTTAGTTTCTAAAACGATTAAGAAGATAACATCATGATGATGAT
TAACTAATAAAATCATAACTAAACTAACATTTAGCCTGGCAATAGCTACTGCTATGGCTA
CTACAATGAAGATGAAAGTAATTTCTTAAATAGCACAAACTTCCTTAACTTAACAAATCT
CCAAATAAACACATAAAACAACACGATGATAGCTATGAGCAATAATTACAATAATAATAA
TAAAGATGTCAATAACTATCCAAATAAAAACTCATCTACAAACGGTAGTTAAGTACTTCA
ACAAAATTACAATGGCACCAACACTAATAATAACATTTACTAACAATATAATATGGGTAA
TAATAACAACAATGATAATATTGGTAATGCTAACTTATCAATGTAGTAAAATAACTTAAG
TAATACTTTGAATTGGACTAATAGTACTAACTTATTTAATAACTCAGTGTGTGCTGGTAG
TATGTTGAATACAACTATAAATAACATCCTTTAAAATATGAATTCAACCCAATCAACTAA
CAACACCTTAAGCGGCAATCCTAATTTTTTAAATTCTAATAACCCAAACAGTAATGCTAA
GGCTGCACCAAATATTTATAGCAGCTTGTCTTAGTAGAATTCAAATACTAATCCAACAAA
CACTAATGCTAATAACACTCCTACAAACACTAACAACAATAACTAAGGAAATAGCTTTTC
ATAAGCAGTTATAAATAATATATCTATTCCTGCAAATGGTCAGACTGACAAGCTTCCACT
TGACACAACACCAAAATAAGTTTCGTTATTCCCTGAGCCAATCCCGAATAAAAACTAATG
CAGCAGCTTAAAGAGCATTCTATATGATTACGTAATGCCAACAATAAAACCTATAACTCG
CCAGTTTAAGTTACTGAGTAGCCATCAACAAAACAATTCTCAGAGCAACTTTTAGCAAAG
CATAAACTTAAATACAAATAATATCTTTGGAAATGAAAGTCTTAGCAACTAAAATAAGTA
ATAAATTTTAAGTTCTCTTAATAAATAGCTAAGCAGCAAAAATTTAAGCAACAATGCTTC
AGCAGCAAATCTAAATTCAAGTAGCAATAATATCAATAACACAAGCAGTATTGTTGAGAA
CAATAACTGTTTAGTTAATAGCAGCTGCAACATGAATAATTTTAATAATTTTAAGAATCC
CTTTAACTTTGATGATTAAAAGAGTGAAAATTACTCTTGCTCTCAAGGTTTCCCAAGCAG
CAACTTCTTAGATTTAAAAGAATAGCAGCAAACTCAACAAAGTCAATAACAAATTTATTA
ATAACTAGGAGAGTCTCAAAATAGCAACTAGGCAACTCCTATTAAAATACATTTAAAAGT
AGATAGCCAATCAGTAAACTCATTCAATAAGAACAATCTATTTTCTTAAAATCAGGGAAC
ACCTGCAATGAAATCTCCTTCTAACAAAGATGATAATATTTATTACCAAAACTAAGGTAC
TCCATAAATGAAATCACCAACAAACAAATAAGAAATCAGTTCCTCGAATCATTAACTCAC
CCCATCTTCTTAGGGTAATGGTGGAAAATTAACTTTTTGTAATAATCCTACAATTATCAT
TTCTTCTGAGAAAGATTAACTTACAATGTAGTAATACAATTTCTCTTTCTCCAACTGTGT
AAACTAACAAAAAAAAATACAATAGTAATAACAATAAGCTTAAGAATAGTAAGAATAAAA
ATAATAGAGTCAAAATACTCTTCATCCTAATTAAATCTTTTCTTCTCCTTAAAAGAATTT
AAAGAAAGATGATGAGAAAAAGAAAGGAAGCAGTTAGAAAAAAGGCAATTTATTAATAAA
TCAAGAGCACAGACTCGTAGAATCCTCTAAGCAAGAATACTCAACCTCCCCTGAAAAACC
TGTGATTAATATTCTTCTGTCTCAATAAATCACTGTTGTTGATGGAATATCATAAGTCTC
ATCTCAAATGTTCAACATTGAATAACCAGATCCCTTTGTGGACTAAAGCCTTATATAAAA
TTTTTGGTCGATCGATTCGTTCTAAATTGGAAAATGTTTAGGTAGAGGAAGATTTGGTAA
TGTCTACTTAAGCAGGTAAATAAATCAATTTTTTATTTTAAATTATTTATTTGAAAATCA
AAGAAGAGTTTAACAATAAAATTTATTTGTATAAAAATTAGACATAAGCTTACAAATATG
CTCTTTGCAATTAAGCAAATAAGCAAGAAGAATTTGATAGAAAGCTGCATGGAAAAATAA
CTCCAACAAGAAATTAAAATTTAGACTTATTTAAATCACCCAAATGTTTTGAAAATGCAC
GGCTTCTTCGATGATAGTTAAAAAATATATCTAATTCTTGAGCTTGCTTCTCATGGAGAT
ATTTATAAAGAAATAAAAAGAGAGGTAGATATTTTAGAATATTGAATCAAAGTTCTAATA
TATTTTTTAAATTAGGCAAACAAGAAATTTACCGAAGAAAAGGCAGCAAATTATATTAGA
CAAGTGTGTGAAGGATTAATTTATTTACATAGTTAAGGTATCATACATAGAGATATAAAA
CCTGAAAATATATTGAATAGCTACGGAGTCCTTAAATTAAGTGATTTTGGCTGGTCAATC
TATACAGAAGAAAAAAGAATGACTTTTTGTGGTACACTCGATTACGTATCTCCAGAAGTT
GTTTCAGGAAAAGACTATGACTTCAAGGTAGATATTTGGAGCATTGGAGTACTAACATAT
GAATTAATCACTGGTAAAGAATCACTTTTATTTTTGTGTTTGTATTGTTTAATTTTTTAT
AATTAATTAATTTAAGGTAAACCACCATTTGAGAACAGACAAAACCATAATGAAGCCTAC
TAAAAGATTTTAATGGTAACTTAATAAATAAATTTTATATCAACTAAAATATTTTAATAA
ATAGGTTAAGTATGATTTTCCTAACTACATTAGCAAAGAAGCCAAAGATTTTATGAGTAA
ACTGCTGGTTGGAGACCCGAATAAGAGAATATCTTTAGAAACTGCTTTAAACCATGAATG
GATCTTAAAAAATACTAGAAACTGCTTAGCTGACTGGGATCCTAAAGTGAGTGAAGCTTG
TTTATGTTTACTTAAATGA