Identifiers and Description

Gene Model Identifier

TTHERM_00925340

Standard Name

None

Aliases

PreTt04342 | 165.m00060 | 3747.m00317

Description

lipid A-disaccharide synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.4%

TetraMine Data

TTHERM_00925340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20694.19.997093137033517e-262lipid A-disaccharide synthase
(517 aa)
OxytrichaContig11920.0.g221.999002769139511e-37Lipid-A-disaccharide synthetas
e
Stentor CoeruleusSteCoe_270452.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925340(coding)
ATGTTGACTCATATTAGCAGAAGATATTTCAGCTTTACAGGCAGAAAGACCATATTTGTT
GCTGCAGGTTCTCCTTCCCACGATTTATAGGCAGCAAACTTTATGAGGGATTTGAAGAAG
AAGAGCAATAATAATTATGATTTTGTTGGTATTGGAGGTCCTTTGATGTAAGCAGAAGGT
CTTAACTAAAGTTATGCAGATATTAATAAATTCATAGATAAGCCATTCTTTCCTTTGAAA
AACTTTATTCGTTTCCACGTTGCCAGATGTTATCATCCCTACATGGCTCCTCTTCACTTC
TTTAATAAGTAAGTTCTCAATTAGGTTGATAAGAGCAGTCTTTTGAAGGATTAAGTTGAA
CTTAGCATTCCTTCTGCTATTATAACTTTCGGTAACGAATTCTTTATGAAAAAGTTATAC
GTTCGTCTTTGCGATCAATACGAATTGCACAATAAAATTAGACCTCCCACTTTCTTCTAT
GATAGAAGTCATATCAACTAAAGATTTGAATTCCAAGATTATTTGGATCACTTCTTTTAC
ACTATTCCTATGAAATAAATTAACTTTTAAAGTTTTACTTACCCCTCAACTTGTGTTGGT
CACGAAGGTGTTGGCAGAGCCATTTAATACCTTTTCTAAAACTCTAAGTAATACGCTAAC
GTTAAGTCTCTTGTCACTGCTAACGGCTTGAAAATTGCAAGCAATCCTAAGCAACACAGA
GAAATTATTGAAAAGCTTGTTGAAGAATAGCGCGGTATCTAACGTGCTCGTTTGGGAATC
AACGAAAGCAAAAACGTCTTCTTACTTGCTCCAGGTAACACTAAGGCTGAAATTAACTTC
GCAGTTAACCTTCTTTCTCGCTCCTTAGAAGAATTCTTCAAGAAACCCTAATTAACTAAC
GTTTCTCGTGATCATTTCACAATTATCATCACTGCTGACAACGCTTAAAACGCTGAATTC
GTCAACTAAGCTGTCTCAAACACTAAGTACTTGAAGACTTTACAAACTATTGTTACTACT
GGAGAAAAGGAAAAATTCGGTGCTATGTGTGCTGCTGATGTTGGTATTCCTCTCAATGGT
GAACTTGTTAGTGAATGCGCTGCTTTACAATTACCCTCTGTTATTATTTCTAATATGAAC
CTTTTCTATGCTTATATTACTTAATTATATAATAATTTCTACTCTGATATCAACTTTGCT
ATTCAAGGTGAAGCCTACCATGAGCTTGTTTCTACTGCTGCTAATCCTTACAAGCTCTCA
GACGAAATTTTCGATTTATATTCTGACCCTAAATTGAGATATCATTTCGCTGAACGTTAC
TAGAATGTTGTTCATGAAATGATTCCTCAAGCCAACTCATAAGATAATATTGTTACTACT
GATGTAGCTACTCTCCACGGAGTTGAAGTCTAAGAACGTGCCTTTACATACGAAACTATC
GCAGCAAAGGTCTTGAAGGCTGCTCGTGCTTATGAAAGCTTAGATAAAAATATTCCCAAT
CACCAAATTGATTAACACAGAAAGGAAAAGCTTATTAAAGCAGCTTTTTGA


>TTHERM_00925340(protein)
MLTHISRRYFSFTGRKTIFVAAGSPSHDLQAANFMRDLKKKSNNNYDFVGIGGPLMQAEG
LNQSYADINKFIDKPFFPLKNFIRFHVARCYHPYMAPLHFFNKQVLNQVDKSSLLKDQVE
LSIPSAIITFGNEFFMKKLYVRLCDQYELHNKIRPPTFFYDRSHINQRFEFQDYLDHFFY
TIPMKQINFQSFTYPSTCVGHEGVGRAIQYLFQNSKQYANVKSLVTANGLKIASNPKQHR
EIIEKLVEEQRGIQRARLGINESKNVFLLAPGNTKAEINFAVNLLSRSLEEFFKKPQLTN
VSRDHFTIIITADNAQNAEFVNQAVSNTKYLKTLQTIVTTGEKEKFGAMCAADVGIPLNG
ELVSECAALQLPSVIISNMNLFYAYITQLYNNFYSDINFAIQGEAYHELVSTAANPYKLS
DEIFDLYSDPKLRYHFAERYQNVVHEMIPQANSQDNIVTTDVATLHGVEVQERAFTYETI
AAKVLKAARAYESLDKNIPNHQIDQHRKEKLIKAAF


>TTHERM_00925340(gene)
ATGTTGACTCATATTAGCAGAAGATATTTCAGCTTTACAGGCAGAAAGACCATATTTGTT
GCTGCAGGTTCTCCTTCCCACGATTTATAGGCAGCAAACTTTATGAGGGATTTGAAGAAG
AAGAGCAATAATAATTATGATTTTGTTGGTATTGGAGGTCCTTTGATGTAAGCAGAAGGT
CTTAACTAAAGTTATGCAGATATTAATAAATTCATAGATAAGCCATTCTTTCCTTTGAAA
AACTTTATTCGTTTCCACGTTGCCAGATGTTATCATCCCTACATGGCTCCTCTTCACTTC
TTTAATAAGTAAGTTCTCAATTAGGTTGATAAGAGCAGTCTTTTGAAGGATTAAGTTGAA
CTTAGCATTCCTTCTGCTATTATAACTTTCGGTAACGAATTCTTTATGAAAAAGTTATAC
GTTCGTCTTTGCGATCAATACGAATTGCACAATAAAATTAGACCTCCCACTTTCTTCTAT
GATAGAAGTCATATCAACTAAAGATTTGAATTCCAAGATTATTTGGATCACTTCTTTTAC
ACTATTCCTATGAAATAAATTAACTTTTAAAGTTTTACTTACCCCTCAACTTGTGTTGGT
CACGAAGGTGTTGGCAGAGCCATTTAATACCTTTTCTAAAACTCTAAGTAATACGCTAAC
GTTAAGTCTCTTGTCACTGCTAACGGCTTGAAAATTGCAAGCAATCCTAAGCAACACAGA
GAAATTATTGAAAAGCTTGTTGAAGAATAGCGCGGTATCTAACGTGCTCGTTTGGGAATC
AACGAAAGCAAAAACGTCTTCTTACTTGCTCCAGGTAACACTAAGGCTGAAATTAACTTC
GCAGTTAACCTTCTTTCTCGCTCCTTAGAAGAATTCTTCAAGAAACCCTAATTAACTAAC
GTTTCTCGTGATCATTTCACAATTATCATCACTGCTGACAACGCTTAAAACGCTGAATTC
GTCAACTAAGCTGTCTCAAACACTAAGTACTTGAAGACTTTACAAACTATTGTTACTACT
GGAGAAAAGGAAAAATTCGGTGCTATGTGTGCTGCTGATGTTGGTATTCCTCTCAATGGT
GAACTTGTTAGTGAATGCGCTGCTTTACAATTACCCTCTGTTATTATTTCTAATATGAAC
CTTTTCTATGCTTATATTACTTAATTATATAATAATTTCTACTCTGATATCAACTTTGCT
ATTCAAGGTGAAGCCTACCATGAGCTTGTTTCTACTGCTGCTAATCCTTACAAGCTCTCA
GACGAAATTTTCGATTTATATTCTGACCCTAAATTGAGATATCATTTCGCTGAACGTTAC
TAGAATGTTGTTCATGAAATGATTCCTCAAGCCAACTCATAAGATAATATTGTTACTACT
GATGTAGCTACTCTCCACGGAGTTGAAGTCTAAGAACGTGCCTTTACATACGAAACTATC
GCAGCAAAGGTCTTGAAGGCTGCTCGTGCTTATGAAAGCTTAGATAAAAATATTCCCAAT
CACCAAATTGATTAACACAGAAAGGAAAAGCTTATTAAAGCAGCTTTTTGA