Identifiers and Description

Gene Model Identifier

TTHERM_00924320

Standard Name

GST61 (Glutathione S-transferase omega 7, TtGSTo7, GSTo7)

Aliases

PreTt21212 | 164.m00105

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00462 ) Glutaredoxin
  • ( TIGR02182 ) glutaredoxin, GrxB family
  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13218.14.00060137295886e-158glutathione S-transferase ...
TAIRAT3G092701.00043611800632e-11glutathione S-transferase, put
ative
IPI(HUMAN)IPI:IPI00019755.32.99896082485731e-09 PROT:P78417|TREMBL:Q5TA03;Q7Z
3T2|ENSEMBL:ENSP00000278062 |R
EFSEQ:NP_004823|H- INV:HIT0000
29367;HIT000054246|VEGA:OTTHUM
P00000020429 Tax_Id=9606 Gluta
thione transferase omega-1
ParameciumDBGSPATP000302320016.99839434845872e-08Paramecium tetraurelia GSPATP0
0030232001 protein
OxytrichaContig10477.0.g271.999896943452e-07Glutathione S-transferase, C-t
erminal domain
FlyBaseFBgn00376972.99969482341167e-06
WormBaseD1053.12.99969482341167e-06WBGene00001790 gst-42 glutathi
one S-transferase
DictyBaseDDB02314339.99925467747895e-06geneDDB0231433
DictyBaseDDB01670029.99925467747895e-06geneDDB0231433 putative glutat
hione S-transferase putative g
lutathione transferase putativ
e glutathione S-transferase pu
tative glutathione transferase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00924320(coding)
ATGGATATTACTGCTACTAACGAACCTGTAAGATTCTACTGCTTTGTTACTTGTCCTTAC
GCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTAAGTACCATATGAATATAATGAAATT
GATCTATTGGTAAATTAATAACTTACTCCTGAGTTCCTAAAAATAAATCCCCTCCATTAA
GTACCAGTGATTATTAACAAGCAAGGATAGACTATATCAGAAAGCTTGGTCTGCTTAGAG
TATCTCAATGATAAATACTAACCTGGCTTGCTTCCTTAAGACAGTTTCTAAAGAGCCCAA
ATCAGAAAATGGATCACATATTATAGTTCTATTGACGCAAAGAAATGGAGAATTTTAGGT
GCTATTAGAAACAAAAATAAAGAAGAAGCTTATCGTATTCTAAATGAAATTTAATAAAAT
TTAAAATTCTTGTCATCTTAAATTGATTTGCCAATTAGAGTTGAATAAAATTCAAAAACC
TTCTTGTTTGGTTCTACTTTTGGGATGGGTGATATTGCTATTCTACCAGTTTTAGATTAA
ATGATTATATTATTTGAAACTGCATTTGGAAAGCATATTTTAAAAGATAATTTGAATGGA
AAAGATGTTGATGCACTAAAAGCACTTTATATTTGGTTTGAAAATACCAAATAGTAACCT
GCATACTAAAAGTCAACATACAAGCTTTAGAGTCTACCATAAAATCCTCTAATTGATGAA
CTTAACTTAAGAAATAACTGGCAATTCGATAAATATTACATAAACTTTGCATAAAGAAAG
TTCTTCCCTAGTGGTTAAATCCCAAAATTATGA


>TTHERM_00924320(protein)
MDITATNEPVRFYCFVTCPYAIRVRTALELLQVPYEYNEIDLLVNQQLTPEFLKINPLHQ
VPVIINKQGQTISESLVCLEYLNDKYQPGLLPQDSFQRAQIRKWITYYSSIDAKKWRILG
AIRNKNKEEAYRILNEIQQNLKFLSSQIDLPIRVEQNSKTFLFGSTFGMGDIAILPVLDQ
MIILFETAFGKHILKDNLNGKDVDALKALYIWFENTKQQPAYQKSTYKLQSLPQNPLIDE
LNLRNNWQFDKYYINFAQRKFFPSGQIPKL


>TTHERM_00924320(gene)
ATGGATATTACTGCTACTAACGAACCTGTAAGATTCTACTGCTTTGTTACTTGTCCTTAC
GCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTAAGTACCATATGAATATAATGAAATT
GATCTATTGGTAAATTAATAACTTACTCCTGAGTTCCTAAAAATAAATCCCCTCCATTAA
GTACCAGTGATTATTAACAAGCAAGGATAGGTAGATTATAAATATTCTTATAATTAAATG
TAATTTATTATTTTATTAGACTATATCAGAAAGCTTGGTCTGCTTAGAGTATCTCAATGA
TAAATACTAACCTGGCTTGCTTCCTTAAGACAGTTTCTAAAGAGCCCAAATCAGAAAATG
GATCACATATTATAGTTCTATTGACGCAAAGAAATGGAGAATTTTAGGTGCTATTAGAAA
CAAAAATAAAGAAGAAGCTTATCGTATTCTAAATGAAATTTAATAAAATTTAAAATTCTT
GTCATCTTAAATTGATTTGCCAATTAGAGTTGAATAAAATTCAAAAACCTTCTTGTTTGG
TTCTACTTTTGGGATGGGTGATATTGCTATTCTACCAGTTTTAGATTAAATGATTATATT
ATTTGAAACTGCATTTGGAAAGTAATTTTATTTTTTAAAATGTTTAATTTTTTGTAAAAT
AAATATCTAACTTTTTTATTTTTTAAGGCATATTTTAAAAGATAATTTGAATGGAAAAGA
TGTTGATGCACTAAAAGCACTTTATATTTGGTTTGAAAATACCAAATAGTAACCTGCATA
CTAAAAGTCAACATACAAGCTTTAGAGTCTACCATAAAATCCTCTAATTGATGAACTTAA
CTTAAGAAATAACTGGCAATTCGATAAATATTACATAAACTTTGCATAAAGAAAGTTCTT
CCCTAGTGGTTAAATCCCAAAATTATGA