Identifiers and Description

Gene Model Identifier

TTHERM_00924320

Standard Name

GST61 (Glutathione S-transferase omega 7, TtGSTo7, GSTo7)

Aliases

PreTt21212 | 164.m00105

Description

Glutathione S-transferase, N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00462 ) Glutaredoxin
  • ( TIGR02182 ) glutaredoxin, GrxB family
  • ( TIGR01262 ) maleylacetoacetate isomerase
  • ( TIGR02196 ) Glutaredoxin-like protein, YruB-family
  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13218.14.00060137295886e-158glutathione S-transferase doma
in-containing protein (270 aa)
WormBaseWBGene000017907.99995585015917e-11locus:gst-42 Probable maleyl
acetoacetate isomerase statu
s:Confirmed UniProt:Q18938
protein_id:CAA91449.1
DictyBaseDDB_G02763511.99940758651679e-10DDB_G0276351 on chromosome: 2
position 6703448 to 6704140
OxytrichaContig19947.0.g225.00206551404915e-10Glutathione S-transferase, N-t
erminal domain
SGDYNL229C9.99925467747895e-06URE2 Nitrogen catabolite repre
ssion transcriptional regulato
r that acts by inhibition of G
LN3 transcription in good nitr
ogen source; has glutathione p
eroxidase activity and can mut
ate to acquire GST activity; a
ltered form creates [URE3] pri
on

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00924320(coding)
ATTAAACTAAAAAAAAAAATATTGCATTTAATTAGATTATAATAATAATTATTAGAATTA
ATTGAATTTTAGATTTTAAAAAAAATGGATATTACTGCTACTAACGAACCTGTAAGATTC
TACTGCTTTGTTACTTGTCCTTACGCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTAA
GTACCATATGAATATAATGAAATTGATCTATTGGTAAATTAATAACTTACTCCTGAGTTC
CTAAAAATAAATCCCCTCCATTAAGTACCAGTGATTATTAACAAGCAAGGATAGACTATA
TCAGAAAGCTTGGTCTGCTTAGAGTATCTCAATGATAAATACTAACCTGGCTTGCTTCCT
TAAGACAGTTTCTAAAGAGCCCAAATCAGAAAATGGATCACATATTATAGTTCTATTGAC
GCAAAGAAATGGAGAATTTTAGGTGCTATTAGAAACAAAAATAAAGAAGAAGCTTATCGT
ATTCTAAATGAAATTTAATAAAATTTAAAATTCTTGTCATCTTAAATTGATTTGCCAATT
AGAGTTGAATAAAATTCAAAAACCTTCTTGTTTGGTTCTACTTTTGGGATGGGTGATATT
GCTATTCTACCAGTTTTAGATTAAATGATTATATTATTTGAAACTGCATTTGGAAAGCAT
ATTTTAAAAGATAATTTGAATGGAAAAGATGTTGATGCACTAAAAGCACTTTATATTTGG
TTTGAAAATACCAAATAGTAACCTGCATACTAAAAGTCAACATACAAGCTTTAGAGTCTA
CCATAAAATCCTCTAATTGATGAACTTAACTTAAGAAATAACTGGCAATTCGATAAATAT
TACATAAACTTTGCATAAAGAAAGTTCTTCCCTAGTGGTTAAATCCCAAAATTATGA


>TTHERM_00924320(protein)
IKLKKKILHLIRLQQQLLELIEFQILKKMDITATNEPVRFYCFVTCPYAIRVRTALELLQ
VPYEYNEIDLLVNQQLTPEFLKINPLHQVPVIINKQGQTISESLVCLEYLNDKYQPGLLP
QDSFQRAQIRKWITYYSSIDAKKWRILGAIRNKNKEEAYRILNEIQQNLKFLSSQIDLPI
RVEQNSKTFLFGSTFGMGDIAILPVLDQMIILFETAFGKHILKDNLNGKDVDALKALYIW
FENTKQQPAYQKSTYKLQSLPQNPLIDELNLRNNWQFDKYYINFAQRKFFPSGQIPKL


>TTHERM_00924320(gene)
AATTAAACTAAAAAAAAAAATATTGCATTTAATTAGATTATAATAATAATTATTAGAATT
AATTGAATTTTAGATTTTAAAAAAAATGGATATTACTGCTACTAACGAACCTGTAAGATT
CTACTGCTTTGTTACTTGTCCTTACGCCATCAGGGTAAGAACCGCTTTAGAACTCCTCTA
AGTACCATATGAATATAATGAAATTGATCTATTGGTAAATTAATAACTTACTCCTGAGTT
CCTAAAAATAAATCCCCTCCATTAAGTACCAGTGATTATTAACAAGCAAGGATAGGTAGA
TTATAAATATTCTTATAATTAAATGTAATTTATTATTTTATTAGACTATATCAGAAAGCT
TGGTCTGCTTAGAGTATCTCAATGATAAATACTAACCTGGCTTGCTTCCTTAAGACAGTT
TCTAAAGAGCCCAAATCAGAAAATGGATCACATATTATAGTTCTATTGACGCAAAGAAAT
GGAGAATTTTAGGTGCTATTAGAAACAAAAATAAAGAAGAAGCTTATCGTATTCTAAATG
AAATTTAATAAAATTTAAAATTCTTGTCATCTTAAATTGATTTGCCAATTAGAGTTGAAT
AAAATTCAAAAACCTTCTTGTTTGGTTCTACTTTTGGGATGGGTGATATTGCTATTCTAC
CAGTTTTAGATTAAATGATTATATTATTTGAAACTGCATTTGGAAAGTAATTTTATTTTT
TAAAATGTTTAATTTTTTGTAAAATAAATATCTAACTTTTTTATTTTTTAAGGCATATTT
TAAAAGATAATTTGAATGGAAAAGATGTTGATGCACTAAAAGCACTTTATATTTGGTTTG
AAAATACCAAATAGTAACCTGCATACTAAAAGTCAACATACAAGCTTTAGAGTCTACCAT
AAAATCCTCTAATTGATGAACTTAACTTAAGAAATAACTGGCAATTCGATAAATATTACA
TAAACTTTGCATAAAGAAAGTTCTTCCCTAGTGGTTAAATCCCAAAATTATGAAAAATGT
TCTTGCTAAATACCTATTGATAAAATCATTTTTTTACTAATCAAAATAAATCTATATTAA
AATGTAATTTACTTTTTATGTTAATATCCCAAAATAGACACATTTTCTGATAT