Identifiers and Description

Gene Model Identifier

TTHERM_00919690

Standard Name

CPG1 (homolog of CAP-G or YCG1 condensin gene)

Aliases

PreTt07065 | 163.m00067 | 3754.m00271

Description

AT hook motif family protein, condensin subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00919690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19204.19.997093137033517e-262AT hook domain-containing prot
ein family protein (1712 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478

Sequences

>TTHERM_00919690(coding)
ATGGAAACAATAGCTGAAGTTTTCAATGAAGTTTAGGAGTCTACCTCAGTCTCTTAAAAG
CAAGTATATGCACTTCTTGAGTAGTATGAAACAAATAAAGCAGTATTTCTTAAAGCAACA
GAGCAATGCTATCTTAAAATTATCAAGAGCTTGCTTAAGGCACCAAGAAAATTAATTGAG
AAATATGAAAAATTGACTGAAAAATTATTTGAAACAGGATATCGTTAGTACGCTCTCAAA
GAAGATTAGTCATCAAAAAAATAAAAGTTAACAAAAAGGGATATCTTTTAACTTTTTTAA
CATTTCTTGGCATTTTTTGCTGGAGCTCTTGACTCCACTTAACTCTAAATAAGAATCTTC
TCTTCTCGTATAATTTTCTAACTCTTAAAGATATTACCTTCAGACACTCTTGTAGATATT
ATTGAAGTAAAAGTTGCTAAGTAATTAATATTAGGTACTCTTTCTTTGATGAAAGAGAAG
AAGGGTAACTTAAAGCACATAGGTATTAAGATTACGTCTTATTTGCAAAAATTAATGGAT
AGAGATGATCTTACAGAAACATAAGAAGCAAAAATTCTTAGAAGCGAAATGATGAAGAGT
ATGTGCATGGACGACTAAGACTAGATTAGAAAATTGGCATTAATCAACTTGGAAATGAAT
GAAAGCACCTTCCCCCATTTAATTAAGAGAATCAGAGATAAAAATCCTGAAATTAGAGCT
ACAGTCTTCAAGAAACTTATTAAAGAATAAATACCTCTTGCTAACTTAAATTTATCTGAT
ATTTATAAACTTATTTATGATGGTTTAGGATCTAGAGAATCATCTGTCCGTGAAGCATGT
ATAAGATATCTTTAGCTCAACTATAATTTGTTTAAGGAAGATGAAGAAAATCCTTAAAAA
AATTAAATTGAAGAAGAAATGGAATTAGAAGAGAACAAAGAAAAAGATGGAGAAAAAGAA
GAAAGCTCTGAAGATAATGAAATTGATGAAGAAAAAACTAAAAAAAAGCAAAGTAAATCT
GCAATTAAGAGATTTTTCACACCAAATAAAGAGACTGCCATGAAAGATTTGAAAATTAAA
ATTTTAAACTTTTTAAAAACCTTTGAAATTGAAAAGAGTCTTTACTACCCTGAATTATAC
GAGAGTTTAGAATTATTAGTAAAGGAAACTATCAAATAAATATTAGATGCTGATAGCTTC
TCAGCATACTTAAAGGATTGCTTTTTAAATCAACTTAGTCTTAAAAAGAAGAAAAAGCAC
ACTTAAATTTCAATCGAAGGAGAAGAGCTATTCCTAATTAGAGTCCTCTGTTAAATGGTT
TAAAATCAAGATGATAGAAAGGAACTCAGTCCTGAATTAGTAGCTGTAGTGGAAGATTGC
TTCCCAAACGGTGTTGATTTCTCTTAAGTGATTGACTACTATTCATTCACTTAGCCTAAT
TTATTTTCCCTCTATTAGGTTCTCCTTTTGGCAGAACTTCTCATTAATTGTGATGAATCA
GGAAGAAATAAAATTGAAGAAACTCTAAAAAATTTAGTTATTAACATGAGTAATACCAAT
TTAATATCCGAAATCCCAACTGATCCTTCTAATGAATACAATGATATTTTCTATTACCTT
GAACCAGATACTGTTATGAATAATATTTTTTCTCAATCATATTTCTTCTCTCCTATCATT
ACATGCTCGTATGAATTACTTCCAATTATAGTTCGTATTTTAAAGAAGATTGTGAGTGAT
GGTAGAGTGAATGTTCAACTTATCTAGCTTATTTCTGAAGTTCATGAGCCTCTAGCTAAA
GACACAGATAATGACTCACATTTTGATTTACCTTCAGAATTGGAAAGAATAAGAAATAGT
ATTAATGAAGAGAAAAAGAAACTCGATAATATTGAAAAAGAATTGTCGAATCTCAAAAAA
AATAAGACAAAATAAAACGAAATTTATCAATTAGAGAAGGAAAAAGATGAAAAATAAGCA
CATCTTAAAATTTGGGAAGAAAAGGAAGATGCTATTTAGTCAAAAATTTTTGATATTTCT
ATGAGAGAGCTTGTATTAGTTTAATCTCTACTCACTTATTGCAAAGTTGATCCTAAAGAT
CCTGCTATTTCAAATTTATTGTAGCAAATCATTTTACCTGGATTACATTCTTCTGATAGA
AGTTTAAACTTCAATTCCTTGAAATCACTTGCTCTCTATGTTTTGATTGATAAAAAGAAT
TGCATTGATTTCTTCTCTGTATTCAGCGATATTTTGGACAAGAGTGAAAACTGCTAGAAT
TGTACTCCACAAGAAATCATTTCATTGAGAAGCATAGTAGATTTCCTACTTCTATATGAT
CTCACTTAAAAGCAATCCCAAGATGACGAAGATATTGACATTCCTCAAACATAAGATTTA
ATACTTAAGTATGCTTATTAAGCTGATATTCTTCTTAGAACTATTTCAATTGAAGGGTTA
AGCAAATTGCTATTTAACGGAAAACTTCAAGACCCACACACTACTATTTGCTTACTTTTG
GTTATTTGGTTTGATACTAAAATCTGCACAAAATAAGGCTTTAAGGCTATTCAGATACTT
TCAACTTTATTTAAGACTTTCACTGCCTCGAACTATTACAATCTTCAAATATTTGAAAAA
GCTTTGGAATTATTCTCGTAGTTGATGGTTACACTTGAGAAGAAAGGATTAGTTTTTAAT
GATGAATATGTTATTTTTGATCATAGCAATGAAAAGTTTATTTCAAAGGCTCTTAGAGTT
GGAATTAACTTAATGTCCTATGAATATCATAATAACACTGAAGTGCTTAAAAACGTTTCT
TCTAATGAATTTCTTCCATAAGAAAGATTCTTCCTTTTCTTGGCATACAAATGCTCAAAA
GAAAGACGCTTCCAATCTCTTTTTGAAAAAATTACTTAGTACTTTGACTTTTACAATAAG
TGCACTACTGAGTAACTATAAATAATTCTTCACTTCTTAAAAGAAGCTATCGAAAATTGC
CCAGTTAGTAAACAGTTCAATTAATTGGAAAAAGTAATTAAAGACAAAATAAAGATTCAA
GATAAAAATGAAAGATAAGAAGAAGATGAAGAAAAAGAAGAATTAAATAAAGTTTTAGGT
AAAGAAAAGAGTGATAAAGAAGAAGCAAATGATGCAGAAAATGGTGAAAATGGCTTAAAG
AATGATGAAGATTAAAAGCTTTATACTTTAAATGCAAAACAATTAAAGATTTGTGATAAA
ATTATTGAACTATTTGAAGGTAACCAACAAGATATTGAAGTTATTGTCAAAAATCTCTTT
TCAAATGGAACGTTGATTAATGACTCTGCTGAGCAAAAGAAGAAAAGAGCTATGATGTAT
GATGAAGAAGATGAAGAAAGAGCAAATAATGAAGAAGATGATGATAATGAAAAAGAAGAA
AAGCCTAAACGTGGTAGACCTGCTAAAAGAAAATCTATCCACCCTAACTCAGACGATGAG
GAAGAAGGAGAAGATGATGATGAATAGGAAGAAGGTGCCTAAGAAGAAACAAAAAGAAGA
GGCAGACCTAAAAAAGATATCTCTGAAGCTTCTCATGCTCCATCATAGAGAGGTAGAAAG
AAAAAAGCTATCTATATTGATTAGGAAGAAGAAGAAGATAATGAAGAGGAAGAAGAATAA
GAAAATAAAGATTCTAAGAAAAACTCTGCAACTAGGAAAGCAAAGAATGCTAAAGAATTA
GAAGATATACTCAATTAAGAGACAGAAGAAGATGAAGATGATGAAGATAGAGAAGAAGTA
ATAAATAAAAGAACATCATCTAGAAGAGCTTAAAAAACAGTTTTACCAGAATCTAATGTT
GCTCAAAAGACTAGCAAAAGAGGAAGAAAGAAAAAAGATGTGTAAGATGAAGTTATTGAA
TAAGATGAAGAAGACGATGAATAAGAAGAAGAAGACATGTCAGCAGAATAAGACATTGAA
GAAGAAGATAAAAAGAATAAAAAATAAGTTGGAAGAAGAGGTAGAAAACCAGCTTCTACT
AAATCTATGGGTTCATCAAGTGAAAAAGAGAGTCCAAAAACTAACAGGAGAGGTAGAAGA
TCAGCATCAAAAGAGAATAAAATATCTGAAGAAAGTGATGAGGAACATAAAGAAACAGAC
AACGAAGATTAAGAAGAGGAATTGTCTTAAAAGAAAACAAGAGGCAGGGGCCGTCCTAAA
AAATCAAATGAAAAGACTTAATCATAGGAAGAAGAAGAAGGATAGGATAATTCATAATCT
GATGAATAAGAAGAAGAGGTGGAGGAAGAAGAAGCCCCTAGAAAAACAAGAGGAAGCTCA
AAAAAAAGTACACCAGCTTAAAAAAAATCAAAAACAAGATCTTCTTAGAAATCCGTTGAT
AATGAAGAGAGTGGTGAAGATGAGGAGCAAGAGGAGTAAAAACCTTAAAAGAAAGGAAGA
GGAAGACCTAAAGCTTAACCTAAAGAACCTGAATCAGAATAAGATGAGCAAAACGAAAGT
GAGCAAGAATAAGAAAATGAAAGTGAATAAGAGGAAGAAGAGGACGATAAGCAGACAAAA
AGAAGGGGAAGAAAACCAAAAAATGTTACTCAAGCAGTGAAAAGAACAACTAGACACAAT
AGTGCTAATAAAAATTCTGATAAAGAAGAGTCTGAAGGAGAAGAAGAAAATGAAGAAGAA
GAGTAAGAGGAAGATGAAGAAGAGTAAACTAGGGTTACTCGTAAGAGGGGTAGAAAACAA
GCTGATACAAAGAAGCCTACCAAGAATGAATCTGTAAGAAGCACAAGAAGAGGAGGTTCT
AGAAATAAAATGGAGGAAGAACATGAAGATGAGGAAGAGAACGAGTCTTCTGAACAAGAG
CATGAAGAGTAAGAAGAAGAGGAGGAAGAGTAAGAGTAGACTAAGACTAGAGGAAGACCT
AAAAAATCACCAGCAAACAAAAGTCAAGCAAAAGAAACTAGGGGAAGAGGTAGAAAAAAA
AATGAAAAATAATAGAGTGACTCATAAAGTGAAGATGAAGGAGAAGAGGAAGAAGATGAA
GAAGATCAATAAGCAAACTAAAGAACAACTAGAAGATAAAAATAATAAATAGAAACCTCG
AAAAAACCAGTGAGCTCCTCCTAAAGACTTAGAAGAAGAAAATGA


>TTHERM_00919690(protein)
METIAEVFNEVQESTSVSQKQVYALLEQYETNKAVFLKATEQCYLKIIKSLLKAPRKLIE
KYEKLTEKLFETGYRQYALKEDQSSKKQKLTKRDIFQLFQHFLAFFAGALDSTQLQIRIF
SSRIIFQLLKILPSDTLVDIIEVKVAKQLILGTLSLMKEKKGNLKHIGIKITSYLQKLMD
RDDLTETQEAKILRSEMMKSMCMDDQDQIRKLALINLEMNESTFPHLIKRIRDKNPEIRA
TVFKKLIKEQIPLANLNLSDIYKLIYDGLGSRESSVREACIRYLQLNYNLFKEDEENPQK
NQIEEEMELEENKEKDGEKEESSEDNEIDEEKTKKKQSKSAIKRFFTPNKETAMKDLKIK
ILNFLKTFEIEKSLYYPELYESLELLVKETIKQILDADSFSAYLKDCFLNQLSLKKKKKH
TQISIEGEELFLIRVLCQMVQNQDDRKELSPELVAVVEDCFPNGVDFSQVIDYYSFTQPN
LFSLYQVLLLAELLINCDESGRNKIEETLKNLVINMSNTNLISEIPTDPSNEYNDIFYYL
EPDTVMNNIFSQSYFFSPIITCSYELLPIIVRILKKIVSDGRVNVQLIQLISEVHEPLAK
DTDNDSHFDLPSELERIRNSINEEKKKLDNIEKELSNLKKNKTKQNEIYQLEKEKDEKQA
HLKIWEEKEDAIQSKIFDISMRELVLVQSLLTYCKVDPKDPAISNLLQQIILPGLHSSDR
SLNFNSLKSLALYVLIDKKNCIDFFSVFSDILDKSENCQNCTPQEIISLRSIVDFLLLYD
LTQKQSQDDEDIDIPQTQDLILKYAYQADILLRTISIEGLSKLLFNGKLQDPHTTICLLL
VIWFDTKICTKQGFKAIQILSTLFKTFTASNYYNLQIFEKALELFSQLMVTLEKKGLVFN
DEYVIFDHSNEKFISKALRVGINLMSYEYHNNTEVLKNVSSNEFLPQERFFLFLAYKCSK
ERRFQSLFEKITQYFDFYNKCTTEQLQIILHFLKEAIENCPVSKQFNQLEKVIKDKIKIQ
DKNERQEEDEEKEELNKVLGKEKSDKEEANDAENGENGLKNDEDQKLYTLNAKQLKICDK
IIELFEGNQQDIEVIVKNLFSNGTLINDSAEQKKKRAMMYDEEDEERANNEEDDDNEKEE
KPKRGRPAKRKSIHPNSDDEEEGEDDDEQEEGAQEETKRRGRPKKDISEASHAPSQRGRK
KKAIYIDQEEEEDNEEEEEQENKDSKKNSATRKAKNAKELEDILNQETEEDEDDEDREEV
INKRTSSRRAQKTVLPESNVAQKTSKRGRKKKDVQDEVIEQDEEDDEQEEEDMSAEQDIE
EEDKKNKKQVGRRGRKPASTKSMGSSSEKESPKTNRRGRRSASKENKISEESDEEHKETD
NEDQEEELSQKKTRGRGRPKKSNEKTQSQEEEEGQDNSQSDEQEEEVEEEEAPRKTRGSS
KKSTPAQKKSKTRSSQKSVDNEESGEDEEQEEQKPQKKGRGRPKAQPKEPESEQDEQNES
EQEQENESEQEEEEDDKQTKRRGRKPKNVTQAVKRTTRHNSANKNSDKEESEGEEENEEE
EQEEDEEEQTRVTRKRGRKQADTKKPTKNESVRSTRRGGSRNKMEEEHEDEEENESSEQE
HEEQEEEEEEQEQTKTRGRPKKSPANKSQAKETRGRGRKKNEKQQSDSQSEDEGEEEEDE
EDQQANQRTTRRQKQQIETSKKPVSSSQRLRRRK


>TTHERM_00919690(gene)
ATGGAAACAATAGCTGAAGTTTTCAATGAAGTTTAGGAGTCTACCTCAGTCTCTTAAAAG
CAAGTATATGCACTTCTTGAGTAGTATGAAACAAATAAAGCAGTATTTCTTAAAGCAACA
GAGCAATGCTATCTTAAAATTATCAAGAGCTTGCTTAAGGCACCAAGAAAATTAATTGAG
AAATATGAAAAATTGACTGAAAAATTATTTGAAACAGGATATCGTTAGTACGCTCTCAAA
GAAGATTAGTCATCAAAAAAATAAAAGTTAACAAAAAGGGATATCTTTTAACTTTTTTAA
CATTTCTTGGCATTTTTTGCTGGAGCTCTTGACTCCACTTAACTCTAAATAAGAATCTTC
TCTTCTCGTATAATTTTCTAACTCTTAAAGATATTACCTTCAGACACTCTTGTAGATATT
ATTGAAGTAAAAGTTGCTAAGTAATTAATATTAGGTACTCTTTCTTTGATGAAAGAGAAG
AAGGGTAACTTAAAGCACATAGGTATTAAGATTACGTCTTATTTGCAAAAATTAATGGAT
AGAGATGATCTTACAGAAACATAAGAAGCAAAAATTCTTAGAGTAATTTAAATAATTTGT
GATTTTTAAATTCAAAATGTGATATGAGACAACATTTATATTATAAATATAGATTCAGAA
TTTTAGTTAGATATTTTCTATAATATTAAAATTTAGTTAGTCTTTTAAAATTTGATGCTG
ATTTTTGGATCAATTTTTTGTTAGTTTGCAAAAAATTAAAAATTTCGCAAACAAAATCAA
AAAAGATATAAAAATTTATTGTCTTAGAATTAAGAGACAGTTTTTATTTAATTATTTATT
TAAGTTTTTTTAACTTTCATTAATTTAAAATATATTTTTTTTATTCACTTAGAGCGAAAT
GATGAAGAGTATGTGCATGGACGACTAAGACTAGATTAGAAAATTGGCATTAATCAACTT
GGAAATGAATGAAAGCACCTTCCCCCATTTAATTAAGAGAATCAGAGATAAAAATCCTGA
AATTAGAGCTACAGTCTTCAAGAAACTTATTAAAGAATAAATACCTCTTGCTAACTTAAA
TTTATCTGATATTTATAAACTTATTTATGATGGTTTAGGATCTAGAGAATCATCTGTCCG
TGAAGCATGTATAAGATATCTTTAGCTCAACTATAATTTGTTTAAGGAAGATGAAGAAAA
TCCTTAAAAAAATTAAGTAAATTAAAGTAAAAAATTTATATTTTAAATAAAAAATTTCAT
TAAATATATAGATTGAAGAAGAAATGGAATTAGAAGAGAACAAAGAAAAAGATGGAGAAA
AAGAAGAAAGCTCTGAAGATAATGAAATTGATGAAGAAAAAACTAAAAAAAAGCAAAGTA
AATCTGCAATTAAGAGATTTTTCACACCAAATAAAGAGACTGCCATGAAAGATTTGAAAA
TTAAAATTTTAAACTTTTTAAAAACCTTTGAAATTGAAAAGAGTCTTTACTACCCTGAAT
TATACGAGAGTTTAGAATTATTAGTAAAGGAAACTATCAAATAAATATTAGATGCTGATA
GCTTCTCAGCATACTTAAAGGATTGCTTTTTAAATCAACTTAGTCTTAAAAAGAAGAAAA
AGCACACTTAAATTTCAATCGAAGGAGAAGAGCTATTCCTAATTAGAGTCCTCTGTTAAA
TGGTTTAAAATCAAGATGATAGAAAGGAACTCAGTCCTGAATTAGTAGCTGTAGTGGAAG
ATTGCTTCCCAAACGGTGTTGATTTCTCTTAAGTGATTGACTACTATTCATTCACTTAGC
CTAATTTATTTTCCCTCTATTAGGTTCTCCTTTTGGCAGAACTTCTCATTAATTGTGATG
AATCAGGAAGAAATAAAATTGAAGAAACTCTAAAAAATTTAGTTATTAACATGAGTAATA
CCAATTTAATATCCGAAATCCCAACTGATCCTTCTAATGAATACAATGATATTTTCTATT
ACCTTGAACCAGATACTGTTATGAATAATATTTTTTCTCAATCATATTTCTTCTCTCCTA
TCATTACATGCTCGTATGAATTACTTCCAATTATAGTTCGTATTTTAAAGAAGGTAAAAA
TTTTTTAGTAAAAAAATATTTGTCAAATTTATGTAATTTTTATTTTTTAAAAATAAAGAT
TGTGAGTGATGGTAGAGTGAATGTTCAACTTATCTAGCTTATTTCTGAAGTTCATGAGCC
TCTAGCTAAAGACACAGATAATGACTCACATTTTGATTTACCTTCAGAATTGGAAAGAAT
AAGAAATAGTATTAATGAAGAGAAAAAGAAACTCGATAATATTGAAAAAGAATTGTCGAA
TCTCAAAAAAAATAAGACAAAATAAAACGAAATTTATCAATTAGAGAAGGAAAAAGATGA
AAAATAAGCACATCTTAAAATTTGGGAAGAAAAGGAAGATGCTATTTAGTCAAAAATTTT
TGATATTTCTATGAGAGAGCTTGTATTAGTTTAATCTCTACTCACTTATTGCAAAGTTGA
TCCTAAAGATCCTGCTATTTCAAATTTATTGTAGCAAATCATTTTACCTGGATTACATTC
TTCTGATAGAAGTTTAAACTTCAATTCCTTGAAATCACTTGCTCTCTATGTTTTGATTGA
TAAAAAGAATTGCATTGATTTCTTCTCTGTATTCAGCGATATTTTGGACAAGAGTGAAAA
CTGCTAGAATTGTACTCCACAAGAAATCATTTCATTGAGAAGCATAGTAGATTTCCTACT
TCTATATGATCTCACTTAAAAGCAATCCCAAGATGACGAAGATATTGACATTCCTCAAAC
ATAAGATTTAATACTTAAGTATGCTTATTAAGGTATTAAATATATCTGATCGACATTATT
CCTTTATCTAATTAAACTTTTTTATTAAAAGCTGATATTCTTCTTAGAACTATTTCAATT
GAAGGGTTAAGCAAATTGCTATTTAACGGAAAACTTCAAGACCCACACACTGTAAAAAAA
ATTTTTTTTAATGCATTTTACTTATTTAAAAAATATTGATTTTTAATTCTAGACTATTTG
CTTACTTTTGGTTATTTGGTTTGATACTAAAATCTGCACAAAATAAGGCTTTAAGGCTAT
TCAGATACTTTCAACTTTATTTAAGACTTTCACTGCCTCGAACTATTACAATCTTCAAAT
ATTTGAAAAAGCTTTGGAATTATTCTCGTAGTTGATGGTTACACTTGAGAAGAAAGGATT
AGTTTTTAATGATGAATATGTTATTTTTGATCATAGCAATGAAAAGTTTATTTCAAAGGC
TCTTAGAGTTGGAATTAACTTAATGTCCTATGAATATCATAATAACACTGAAGTGCTTAA
AAACGTTTCTTCTAATGAATTTCTTCCATAAGAAAGATTCTTCCTTTTCTTGGCATACAA
ATGCTCAAAAGAAAGACGCTTCCAATCTCTTTTTGAAAAAATTACTTAGTACTTTGACTT
TTACAATAAGTGCACTACTGAGTAACTATAAATAATTCTTCACTTCTTAAAAGAAGCTAT
CGAAAATTGCCCAGTTAGTAAACAGTTCAATTAATTGGAAAAAGTAATTAAAGACAAAAT
AAAGATTCAAGATAAAAATGAAAGATAAGAAGAAGATGAAGAAAAAGAAGAATTAAATAA
AGTTTTAGGTAAAGAAAAGAGTGATAAAGAAGAAGCAAATGATGCAGAAAATGGTGAAAA
TGGCTTAAAGAATGATGAAGATTAAAAGCTTTATACTTTAAATGCAAAACAATTAAAGAT
TTGTGATAAAATTATTGAACTATTTGAAGGTAACCAACAAGATATTGAAGTTATTGTCAA
AAATCTCTTTTCAAATGGAACGTTGATTAATGACTCTGCTGAGCAAAAGAAGAAAAGAGC
TATGATGTATGATGAAGAAGATGAAGAAAGAGCAAATAATGAAGAAGATGATGATAATGA
AAAAGAAGAAAAGCCTAAACGTGGTAGACCTGCTAAAAGAAAATCTATCCACCCTAACTC
AGACGATGAGGAAGAAGGAGAAGATGATGATGAATAGGAAGAAGGTGCCTAAGAAGAAAC
AAAAAGAAGAGGCAGACCTAAAAAAGATATCTCTGAAGCTTCTCATGCTCCATCATAGAG
AGGTAGAAAGAAAAAAGCTATCTATATTGATTAGGAAGAAGAAGAAGATAATGAAGAGGA
AGAAGAATAAGAAAATAAAGATTCTAAGAAAAACTCTGCAACTAGGAAAGCAAAGAATGC
TAAAGAATTAGAAGATATACTCAATTAAGAGACAGAAGAAGATGAAGATGATGAAGATAG
AGAAGAAGTAATAAATAAAAGAACATCATCTAGAAGAGCTTAAAAAACAGTTTTACCAGA
ATCTAATGTTGCTCAAAAGACTAGCAAAAGAGGAAGAAAGAAAAAAGATGTGTAAGATGA
AGTTATTGAATAAGATGAAGAAGACGATGAATAAGAAGAAGAAGACATGTCAGCAGAATA
AGACATTGAAGAAGAAGATAAAAAGAATAAAAAATAAGTTGGAAGAAGAGGTAGAAAACC
AGCTTCTACTAAATCTATGGGTTCATCAAGTGAAAAAGAGAGTCCAAAAACTAACAGGAG
AGGTAGAAGATCAGCATCAAAAGAGAATAAAATATCTGAAGAAAGTGATGAGGAACATAA
AGAAACAGACAACGAAGATTAAGAAGAGGAATTGTCTTAAAAGAAAACAAGAGGCAGGGG
CCGTCCTAAAAAATCAAATGAAAAGACTTAATCATAGGAAGAAGAAGAAGGATAGGATAA
TTCATAATCTGATGAATAAGAAGAAGAGGTGGAGGAAGAAGAAGCCCCTAGAAAAACAAG
AGGAAGCTCAAAAAAAAGTACACCAGCTTAAAAAAAATCAAAAACAAGATCTTCTTAGAA
ATCCGTTGATAATGAAGAGAGTGGTGAAGATGAGGAGCAAGAGGAGTAAAAACCTTAAAA
GAAAGGAAGAGGAAGACCTAAAGCTTAACCTAAAGAACCTGAATCAGAATAAGATGAGCA
AAACGAAAGTGAGCAAGAATAAGAAAATGAAAGTGAATAAGAGGAAGAAGAGGACGATAA
GCAGACAAAAAGAAGGGGAAGAAAACCAAAAAATGTTACTCAAGCAGTGAAAAGAACAAC
TAGACACAATAGTGCTAATAAAAATTCTGATAAAGAAGAGTCTGAAGGAGAAGAAGAAAA
TGAAGAAGAAGAGTAAGAGGAAGATGAAGAAGAGTAAACTAGGGTTACTCGTAAGAGGGG
TAGAAAACAAGCTGATACAAAGAAGCCTACCAAGAATGAATCTGTAAGAAGCACAAGAAG
AGGAGGTTCTAGAAATAAAATGGAGGAAGAACATGAAGATGAGGAAGAGAACGAGTCTTC
TGAACAAGAGCATGAAGAGTAAGAAGAAGAGGAGGAAGAGTAAGAGTAGACTAAGACTAG
AGGAAGACCTAAAAAATCACCAGCAAACAAAAGTCAAGCAAAAGAAACTAGGGGAAGAGG
TAGAAAAAAAAATGAAAAATAATAGAGTGACTCATAAAGTGAAGATGAAGGAGAAGAGGA
AGAAGATGAAGAAGATCAATAAGCAAACTAAAGAACAACTAGAAGATAAAAATAATAAAT
AGAAACCTCGAAAAAACCAGTGAGCTCCTCCTAAAGACTTAGAAGAAGAAAATGA