Identifiers and Description

Gene Model Identifier

TTHERM_00913390

Standard Name

None

Aliases

PreTt23743 | 162.m00072

Description

E1-E2 ATPase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ATP binding (IEA) | GO:0005524
  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820

Biological Process

Domains

  • ( PF00122 ) E1-E2 ATPase
  • ( TIGR00099 ) Cof-like hydrolase
  • ( PF00702 ) haloacid dehalogenase-like hydrolase
  • ( PF08282 ) haloacid dehalogenase-like hydrolase
  • ( TIGR01511 ) copper-translocating P-type ATPase
  • ( PF00690 ) Cation transporter/ATPase, N-terminus
  • ( PF07134 ) Protein of unknown function (DUF1383)
  • ( PF07872 ) Protein of unknown function (DUF1659)
  • ( TIGR01512 ) cadmium-translocating P-type ATPase
  • ( TIGR01524 ) magnesium-translocating P-type ATPase
  • ( TIGR01525 ) heavy metal translocating P-type ATPase
  • ( TIGR01647 ) plasma-membrane proton-efflux P-type ATPase
  • ( TIGR01522 ) calcium-transporting P-type ATPase, PMR1-type
  • ( TIGR01517 ) calcium-translocating P-type ATPase, PMCA-type
  • ( TIGR01116 ) calcium-translocating P-type ATPase, SERCA-type
  • ( TIGR01652 ) phospholipid-translocating P-type ATPase, flippase
  • ( TIGR01657 ) P-type ATPase of unknown pump
  • ( TIGR01494 ) ATPase, P-type (transporting), HAD superfamily,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00913390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10471.19.997093137033517e-262E1-E2 ATPase (1375 aa)
OxytrichaContig21988.0.g649.997093137033517e-262E1-E2 ATPase
SGDYOR291W5.002376098066827e-140YPK9 Vacuolar protein with a p
ossible role in sequestering h
eavy metals; has similarity to
the type V P-type ATPase Spf1
p; homolog of human ATP13A2 (P
ARK9), mutations in which are
associated with Parkinson dise
ase and Kufor-Rakeb syndrome
WormBaseWBGene000123412.0001701965494945e-132locus:catp-6 status:Confirme
d UniProt:D3YT44 protein_i
d:CBK19479.1
DictyBaseDDB_G02791839.000740126599256e-127kil2 on chromosome: 3 position
1731085 to 1734690
Stentor CoeruleusSteCoe_350574.2960271311739114e-61

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00913390(coding)
ATGTCTAAAAATATCAATGATAATTTACATCTCAGTGACTGCTAATAGCCACTTTTAGAA
TTTGACACTCAAAATAAAGCAGAGTAAAAATTTATATTCAACAACGTAAATTTTACTCTG
CCTTGGAATGTTTAAGAAGAAGGCGTTATAAAAATGATAGAGTCATTTAAAGTATCTCCA
ATTAAGATGATCGTTTTCTATTTTTTAAATTTTTTAACTTTTGGAGTGATCTATCTATTT
ACTAGATGGTAGGTTACACTTAGAATTAAGTTATAAATGGAGCCATGTATTCCTAATGAG
GCAGAATTCTTGTTAATTACTTCAGATGATGAAACGTAGAGTTTAGAAAAAATAATGATT
TAATAAATGGGATTTAATGGAATAGATTCTATTTAAACATACAAAACCTTCACATATAGG
TTATATAAGTTCTACTTTAATGAGAACAAATATAATCCTATCCAGATCGACTTAACAAGG
CTATCTAATAGATAAATCATAGACTCATATGGTAAAGGGTTAAGAGATGAAAACACCTTT
TCTTAATAGGTATCAATATATGGATTAAATAATACTGAAATACCTCAAAAACCTACCATT
AAAATATTGATTTACGAAGTACTTTCTCCTTTTTACATGTTTCAACTTTTTAGTTTTTTG
CTTTGGATGATCTTACCTTACTATTTCTATGCTTCTATTATTTTAATTACCTCTGTTGTA
TCAGCTATAGTCACTCTAAACGAAGCAAAATCTAACTATAAAAAATTATAAGAAATGAGC
TACTTCGAAACGCCAGTATTTTCTTATAGATATTTGCCAGATAAAATTAAAATTGAAAAT
GGGGAACTTAAATTATGTGAGAATATAATAAGTCATAGAAAGTAAATAAGCTCTTTGCAC
TTAGTTCCTGGCGATATTATAGAAATATAGGATGGATAAACAATACCTTGTGATATTATT
TTGCTTAATGGGTAGTGTATTATGAATGAATCTATGCTTACTGGTGAATCAATTCCAATT
GTTAAGCAGAGCTTACCTTATAATGAAAATAGATACGATTACTTGAATGATGGAAAATAA
TCTACTTTGTTTGCTGGAACAAAGTGCATAGAAACAAGAATACATCTAAAAGGAAAAATT
CCAGTTATTGGATTGGTCAGTCAGACCAGTTTTAACACTTTAAAGGGATAGCTTGTACGA
TCTATTTTATATCCAAAACAAAATTCTTTTTCATTTTATACTGATTCGATGAGATTTATT
GCTGTTATGGCAGCTATGTCTCTTTTGGGTTTTTTTGTTTCTCTACCAGACTGGATTGAG
GGTATTAATGAGGGTTTTGTTACTTATACAGAAATGTTCCTTGAGTGTTTGGATCTGGTT
ACTGTCACAGTCCCGCCAGCTCTTCCTACTTGCCTTTCTATTGGTATTTCTTTTGCGATG
TCTCGTCTCAAAAAATAATAAATCTTCTGCATATCTCCTCCCAAAGTTAATATTTGTGGC
AAAGTTACTGTCATGTGCTTTGATAAAACTGGAACATTAACAGAAGAAGGTCTAGATATG
TATGGAGTAAGAAGTATAAGATATACTTAAGGCAGGAAGGTAAAGTTTAACAAGCTAACT
GAGGATATTCAAGGGATGGGATTATAAGAAATTTAAAGCAAATCTCTAAACTAAATTCAA
AAAACTCAGCTTTATGGAAATAAAAATCCTTTTATTTATTTAGAAGATCCAGATGTAGTC
TTTAAGGAATGTATGGCAAGTTGTCATAGTATAACAAGGGTAAATAATTAAATAATTGGA
GATCCTTTAGAGATTAAGATGTTTGAAGCCACAAAATGGATACTTTTAGAAGAAAACATT
TCTTAAAACTATGAATTTAAAATGTAAGCTCTAGTAAAAGACAACGAAGGCCATTCTCAA
TTGGCTATAATAAAAAGATTTGAGTTCTCTTCAAAACTCTAAAGAATGAGCTCAATAGTT
AAGAAAATAGGTAATAATTAACCCTTTTATCGTCTTCATGTTAAAGGATCCCCAGAGAAA
ATTCATGATTTATCAAACCCTGAAACCATTCCAGATAACTATCATGAGGTTTTAGATTTT
TATGCAAGAAAAGGTTTTAGAATAATTTCATTTGCTATTAAAAACTTGGATATGAGGATC
GAAGATGTATACAAATGTGAAAGAGATCAAATTGAAAACTAATTAACATTTGTTGGGATG
CTGATAATGGAAAACAAGTTAAAGCCTGAGACGAAAGGAATTATTAATGATTTAAATAAT
GCAAATATTCGCACGATTATGGTTACAGGAGACAATTCTCTTACAGCTATTTCTGTAGCT
AGGCAGTGTTTAATAGTTAATAATTCAACTAGAGTATATTTTGGTGATATTGATGAGGAA
AATCATCATGAAAGTGAAATTGTTTGGAAGGACTTTGAACACTCAGATAAATACCTTGAT
GAAGAAAATTTATAACCAATTGATGGGATTGCAGACTACATAGAAGATGGTATTTAAGAG
ATTTAAGAAGAAAAAATACTGTTTAACATTTTGGAATAGAGCAATTAATAATGTTTAACT
TCAAAACCTTTATAACTAAATAAGACTATTAAGGAATAAATAGATATGATAAGAAAATCA
ATATAAAGTAACACAGATAACTCTTCTACTAATTTTATAAGATAAAACTCTGTAACTTAG
AAGTATGCAGATACTAATTTCAAAGATCAAATTTAAGAATTTGAAGAAAGTTAACTTCAA
TACCCTTGGCTAAATGACGATCACTTTGTATTAGCTGTAACTGGAAGAGCCTTCTCAAAA
ATAATTTCTGAATCTAAACAGAGTCATGCTAAGTAGAATCTAGCAGAAATTATGCTTTAA
AAAACTTAGATATATGCCAGAATGAGGCCAGAAGAAAAGACATTGTTATTATAATCATTA
TAAGAGCTACCTTCAAAACCTGTATGTGGGATGTGTGGAGATGGAGCAAATGACTGTGGT
GCTCTAAAGACAGCAGATGTGGGAATTTCTTTATCAGAAGCAGAAGCCTCAATAGCAGCC
CCTTTTACTTCTAAAGTACAGAATATATCTTGCGTTGTTCATCTTTTAAAAGAGGGAAGA
GCAGCACTTGTAACCAGCTTTTCTTGCTTCAAATTTATGGCTTTATATTCTGCAATTTAA
TTCTTTACTACCACTTTACTCTATACTGTCTAATCAATACCCAGTGATACATAACTCCTT
TATTGGGATGTTGCTGTTATCCTGCCTCTTGCTTTTTTTATGGGACTTACAGACTCTTGT
GATAATCTATCTAAATAAGTACCTGGATCTAGTCTTGTTTCATTTTAAGTTCTTTCATCA
GTTATTGGATAAACTGTTTTAAATGGAGCTTTTTAAGCTTACATGTTTTTACATCTGAAA
AAATAACCTTGGTACTTGTCAGTTAAAGATGCTCACACTTATCTTGGCGATCTAGAAGAT
CTAGATGAAAGGAAAAATTGCTTTGAATCAACAACTCTCTTTCTGTTCAGCAGCTATCAA
TATATAGCTACTTGTTTAGCTTTTTCCATAGGAAAACCTTTTAAAAAACCATTCTATACA
AATACTTGGTTTACCATTTCAGTCATTGCAATACTTATATTTTCGTTGTACGTTCATTTG
TTCTCTGGTCAATTCTTATAATAGTTTTTAAATATTTTTTTGACGGTTCAAAGAGAAGAT
GAAGAAAAACCCTTAACAGTAATGCCTAATTCTTGGCTTTATTTTATATTATTTGTTGCT
GGAATAAATTTTATTTGCTGCTTTATTTATGAGGAAGTAATAGTTAAATTACTGTGCTGG
GTATATAATAAATGCAAACTCATATATTTAAATAAATGA


>TTHERM_00913390(protein)
MSKNINDNLHLSDCQQPLLEFDTQNKAEQKFIFNNVNFTLPWNVQEEGVIKMIESFKVSP
IKMIVFYFLNFLTFGVIYLFTRWQVTLRIKLQMEPCIPNEAEFLLITSDDETQSLEKIMI
QQMGFNGIDSIQTYKTFTYRLYKFYFNENKYNPIQIDLTRLSNRQIIDSYGKGLRDENTF
SQQVSIYGLNNTEIPQKPTIKILIYEVLSPFYMFQLFSFLLWMILPYYFYASIILITSVV
SAIVTLNEAKSNYKKLQEMSYFETPVFSYRYLPDKIKIENGELKLCENIISHRKQISSLH
LVPGDIIEIQDGQTIPCDIILLNGQCIMNESMLTGESIPIVKQSLPYNENRYDYLNDGKQ
STLFAGTKCIETRIHLKGKIPVIGLVSQTSFNTLKGQLVRSILYPKQNSFSFYTDSMRFI
AVMAAMSLLGFFVSLPDWIEGINEGFVTYTEMFLECLDLVTVTVPPALPTCLSIGISFAM
SRLKKQQIFCISPPKVNICGKVTVMCFDKTGTLTEEGLDMYGVRSIRYTQGRKVKFNKLT
EDIQGMGLQEIQSKSLNQIQKTQLYGNKNPFIYLEDPDVVFKECMASCHSITRVNNQIIG
DPLEIKMFEATKWILLEENISQNYEFKMQALVKDNEGHSQLAIIKRFEFSSKLQRMSSIV
KKIGNNQPFYRLHVKGSPEKIHDLSNPETIPDNYHEVLDFYARKGFRIISFAIKNLDMRI
EDVYKCERDQIENQLTFVGMLIMENKLKPETKGIINDLNNANIRTIMVTGDNSLTAISVA
RQCLIVNNSTRVYFGDIDEENHHESEIVWKDFEHSDKYLDEENLQPIDGIADYIEDGIQE
IQEEKILFNILEQSNQQCLTSKPLQLNKTIKEQIDMIRKSIQSNTDNSSTNFIRQNSVTQ
KYADTNFKDQIQEFEESQLQYPWLNDDHFVLAVTGRAFSKIISESKQSHAKQNLAEIMLQ
KTQIYARMRPEEKTLLLQSLQELPSKPVCGMCGDGANDCGALKTADVGISLSEAEASIAA
PFTSKVQNISCVVHLLKEGRAALVTSFSCFKFMALYSAIQFFTTTLLYTVQSIPSDTQLL
YWDVAVILPLAFFMGLTDSCDNLSKQVPGSSLVSFQVLSSVIGQTVLNGAFQAYMFLHLK
KQPWYLSVKDAHTYLGDLEDLDERKNCFESTTLFLFSSYQYIATCLAFSIGKPFKKPFYT
NTWFTISVIAILIFSLYVHLFSGQFLQQFLNIFLTVQREDEEKPLTVMPNSWLYFILFVA
GINFICCFIYEEVIVKLLCWVYNKCKLIYLNK


>TTHERM_00913390(gene)
ATGTCTAAAAATATCAATGATAATTTACATCTCAGTGACTGCTAATAGCCACTGTAAATT
AATCTTATTTATGCATGCAATGCAAACACACATTTTATTGAAATCAAATTATAATTCATT
GTTAATAGAACAAATTTTGTTTATAAAATCTAGTAAAGTTTGCTAAACCATTAATATAAG
ACTTAAAAATTACTTTAAAACATTTAAATGCAAATGGAATCTGTTTTTATTTTTATTTTT
TGCCTTCAAAGCTGAATGGTCTATTAAAAAAATTACTCTATTTTTAAATAATTAGTTTAG
AATTTGACACTCAAAATAAAGCAGAGTAAAAATTTATATTCAACAACGTAAATTTTACTC
TGCCTTGGAATGTTTAAGAAGAAGGCGTTATAAAAATGATAGAGTCATTTAAAGTATCTC
CAATTAAGATGATCGTTTTCTATTTTTTAAATTTTTTAACTTTTGGAGTGATCTATCTAT
TTACTAGATGGTAGGTTACACTTAGAATTAAGTTATAAATGGAGCCATGTATTCCTAATG
AGGCAGAATTCTTGTTAATTACTTCAGATGGTAAATATTTCTGCTTTTTAAAATGGTTGA
TGTGAAATATATTCCAAACTTATCAAAAGATGAAACGTAGAGTTTAGAAAAAATAATGAT
TTAATAAATGGGATTTAATGGAATAGATTCTATTTAAACATACAAAGTAATATTTGATAT
ATCTTTCTTAAATAAATTAATTAAATTGTAAAATTATATAAGACCTTCACATATAGGTTA
TATAAGTTCTACTTTAATGAGAACAAATATAATCCTATCCAGATCGACTTAACAAGGCTA
TCTAATAGATAAATCATAGACTCATATGGTAAAGGGTTAAGAGATGAAAACACCTTTTCT
TAATAGGTATCAATATATGGATTAAATAATACTGAAATACCTCAAAAACCTACCATTAAA
ATATTGATTTACGAAGTACTTTCTCCTTTTTACATGTTTCAACTTTTTAGTTTTTTGCTT
TGGATGATCTTACCTTACTATTTCTATGCTTCTATTATTTTAATTACCTCTGTTGTATCA
GCTATAGTCACTCTAAACGAAGCAAAATCTAACTATAAAAAATTATAAGAAATGAGCTAC
TTCGAAACGCCAGTATTTTCTTATAGATATTTGCCAGATAAAATTAAAATTGTAATTTCT
TTATTACCATAAATATACTTTATAAAAATGTTATCAAATATTAATTAATTAAGAACATTA
TTTGCTATAAAAAAATGCTTTTATTTTGAAAAATTTGCTAATTTATTTATTTATCTATTT
TTAATTTAAAAGGAAAATGGGGAACTTAAATTATGTGAGAATATAATAAGTCATAGAAAG
TAAATAAGCTCTTTGCACTTAGTTCCTGGCGATATTATAGAAATATAGGATGGATAAACA
ATACCTTGTGATATTATTTTGCTTAATGGGTAGTGTATTATGAATGAATCTATGCTTACT
GGTGAATCAATTCCAATTGTTAAGCAGAGCTTACCTTATAATGAAAATAGATACGATTAC
TTGAATGATGGAAAATAATCTACTTTGTTTGCTGGAACAAAGTGCATAGAAACAAGAATA
CATCTAAAAGGAAAAATTCCAGTTATTGGATTGGTCAGTCAGACCAGTTTTAACACTTTA
AAGGGATAGCTTGTACGATCTATTTTATATCCAAAACAAAATTCTTTTTCATTTTATACT
GATTCGATGAGATTTATTGCTGTTATGGCAGCTATGTCTCTTTTGGGTTTTTTTGTTTCT
CTACCAGACTGGATTGAGGGTATTAATGAGGGTTTTGTTACTTATACAGAAATGTTCCTT
GAGTGTTTGGATCTGGTTACTGTCACAGTCCCGCCAGCTCTTCCTACTTGCCTTTCTATT
GGTATTTCTTTTGCGATGTCTCGTCTCAAAAAATAATAAATCTTCTGCATATCTCCTCCC
AAAGTAAGTTATAGAATAATATTTTTATACTTAAAATTATTAATATGTATTTAATTAGGT
TAATATTTGTGGCAAAGTTACTGTCATGTGCTTTGATAAAACTGGAACATTAACAGAAGA
AGGTCTAGATATGTATGGAGTAAGAAGTATAAGATATACTTAAGGCAGGAAGGTAAAGTT
TAACAAGCTAACTGAGGATATTCAAGGGATGGGATTATAAGAAATTTAAAGCAAATCTCT
AAACTAAATTCAAAAAACTCAGCTTTATGGAAATAAAAATCCTTTTATTTATTTAGAAGA
TCCAGATGTAGTCTTTAAGGAATGTATGGCAAGTTGTCATAGTATAACAAGGGTAAATAA
TTAAATAATTGGAGATCCTTTAGAGATTAAGATGTTTGAAGCCACAAAATGGATACTTTT
AGAAGAAAACATTTCTTAAAACTATGAATTTAAAATGTAAGCTCTAGTAAAAGACAACGA
AGGCCATTCTCAATTGGCTATAATAAAAAGATTTGAGTTCTCTTCAAAACTCTAAAGAAT
GAGCTCAATAGTTAAGAAAATAGGTAATAATTAACCCTTTTATCGTCTTCATGTTAAAGG
ATCCCCAGAGAAAATTCATGATTTATCAAACCCTGAAACCATTCCAGATAACTATCATGA
GGTAAATTTATTGAATTATTTTTTATAATAATTTTTTTAAATATTAAAATTACTCTAAAT
CTATTTTTTTACACTAAGCTTAAAAATAATTTAAGAATATTATGAAGCAAAGATAAATAA
TTAAAATAAAGGAAAAGATATTTTTTGATTCCAATCAATAATTTGACAAATTTAACTTTA
TTATTTTCTTTTAATTTTCAATAATTTTAAGTTTAATAAAAAGAAGGAATTGTTTATTTA
TTTTGATTAATTTTACTAAATATTTCTTTCTTTTAACTTTAAAAAATTTTAAGCTTAACT
AAATTTATTTCTTTTTACTAAATAAATTATTTAATTTAATTTATTTAAATTATTCTAAAA
TTTATTTGAGATTATTTTTCTTTTTATATTTTATTTAAAAATATTTTTTTTAGTTTCTTT
TAATTATAATTTGGTTTATTGAATAGGTTTTAGATTTTTATGCAAGAAAAGGTTTTAGAA
TAATTTCATTTGCTATTAAAAACTTGGATATGAGGATCGAAGATGTATACAAATGTGAAA
GAGATCAAATTGAAAACTAATTAACATTTGTTGGGATGCTGATAATGGAAAACAAGTTAA
AGCCTGAGACGAAAGGAATTATTAATGATTTAAATAATGCAAATATTCGCACGATTATGG
TTACAGGAGACAATTCTCTTACAGCTATTTCTGTAGCTAGGCAGTGTTTAATAGTTAATA
ATTCAACTAGAGTATATTTTGGTGATATTGATGAGGAAAATCATCATGAAAGTGAAATTG
TTTGGAAGGACTTTGAACACTCAGATAAATACCTTGATGAAGAAAATTTATAACCAATTG
ATGGGATTGCAGACTACATAGAAGATGGTATTTAAGAGATTTAAGAAGAAAAAATACTGT
TTAACATTTTGGAATAGAGCAATTAATAATGTTTAACTTCAAAACCTTTATAACTAAATA
AGACTATTAAGGAATAAATAGATATGATAAGAAAATCAATATAAAGTAACACAGATAACT
CTTCTACTAATTTTATAAGATAAAACTCTGTAACTTAGAAGTATGCAGATACTAATTTCA
AAGATCAAATTTAAGAATTTGAAGAAAGTTAACTTCAATACCCTTGGCTAAATGACGATC
ACTTTGTATTAGCTGTAACTGGAAGAGCCTTCTCAAAAATAATTTCTGAATCTAAACAGA
GTCATGCTAAGTAGAATCTAGCAGAAATTATGCTTTAAAAAACTTAGATATATGCCAGAA
TGAGGCCAGAAGAAAAGACATTGTTATTATAATCATTATAAGAGCTACCTTCAAAACCTG
TATGTGGGATGTGTGGAGATGGAGCAAATGACTGTGGTGCTCTAAAGACAGCAGATGTGG
GAATTTCTTTATCAGAAGCAGAAGCCTCAATAGCAGCCCCTTTTACTTCTAAAGTACAGA
ATATATCTTGCGTTGTTCATGTAATAATCCTGAAAAAATAAATTAAAATGTTTAGATTTT
GCTTTTTATTTTTAAAAGAATTTTTTATTGTAAATAAATTAAACTTTTTTTATAGCTTTT
AAAAGAGGGAAGAGCAGCACTTGTAACCAGCTTTTCTTGCTTCAAATTTATGGCTTTATA
TTCTGCAATTTAATTCTTTACTACCACTTTACTCTATACTGTCTAATCAATACCCAGTGA
TACATAACTCCTTTATTGGGATGTTGCTGTTATCCTGCCTCTTGCTTTTTTTATGGGACT
TACAGACTCTTGTGATAATCTATCTAAATAAGTACCTGGATCTAGTCTTGTTTCATTTTA
AGTTCTTTCATCAGTTATTGGATAAACTGTTTTAAATGGAGCTTTTTAAGTAAAATATAA
AAAAATATATTTATTTTATTTTGAATAATTTGAATTATAAATTGTATTAAGGCTTACATG
TTTTTACATCTGAAAAAATAACCTTGGTACTTGTCAGTTAAAGATGCTCACACTTATCTT
GGCGATCTAGAAGATCTAGATGAAAGGAAAAATTGCTTTGAATCAACAGTAAAATTTGAT
AAAATAATCTAACAAAAATAAATTATTTTTATTAAATAAATTAAAAATAAGACTCTCTTT
CTGTTCAGCAGCTATCAATATATAGCTACTTGTTTAGCTTTTTCCATAGGAAAACCTTTT
AAAAAACCATTCTATACAAATACTTGGTTTACCATTTCAGTCATTGCAATACTTATATTT
TCGTTGTACGTTCATTTGTTCTCTGGTCAATTCTTATAATAGTTTTTAAATGTAATTTCA
TTTAAGCCATTTTTATCTTTAATTATTTTAATATTTTTTATTAAAAGATTTTTTTGACGG
TTCAAAGAGAAGATGAAGAAAAACCCTTAACAGTAATGCCTAATTCTTGGCTTTATTTTA
TATTATTTGTTGCTGGAATAAATTTTATTTGCTGCTTTATTTATGAGGAAGTAATAGTTA
AATTACTGTGCTGGGTATATAATAAATGCAAACTCATATATTTAAATAAATGA