Identifiers and Description

Gene Model Identifier

TTHERM_00877070

Standard Name

None

Aliases

PreTt09703 | 156.m00087

Description

TRAF-type zinc finger family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00877070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03178.19.997093137033517e-262TRAF-type zinc finger family p
rotein (456 aa)
OxytrichaContig17395.0.g675.002171138422328e-22TRAF-type zinc finger
DictyBaseDDB_G02932020.000000000010004361180063202DDB_G0293202 on chromosome: 6
position 2718912 to 2720315
WormBaseWBGene000066120.00000039992052383199455locus:trf-1 status:Partially
_confirmed UniProt:G5EG80
protein_id:CAB07615.2
SGDYNL023C0.00010003404299092957FAP1 Protein that binds to Fpr
1p, conferring rapamycin resis
tance by competing with rapamy
cin for Fpr1p binding; accumul
ates in the nucleus upon treat
ment of cells with rapamycin;
has similarity to D. melanogas
ter shuttle craft and human NF
X1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00877070(coding)
ATGAATCCAATAAGGTAAATTCAAAATCAATATGGATCTCCTAGTTAGCCCTCGCAAACC
TAGCCATAGCCTTAGTCATTTTATTAGAATAATTTTTCTCCTCAGCATTAAATCTAACCT
TAGCAAGTAATTTTACAGCAACAATTAAATATAAATCATCAGAGAGCAAGTTTTCCTCCT
CCACCAATTATTTAACCTTAGAATTACTTTCCTCTTTTTCCATCTTTAAACCAGACTCCA
ACTTAGCAGTAATTTTAACAACAAAGAGGATTTGTTATTCCTCACAGAGAAGCAAATACA
TCTATTTTCACTATGGCAGAAGTGTAAGAAAGGCCTGAGTCTCTAGAATAAAACAATTTA
AAGAATATGCAAGAATTCATGAATTTCATAGATACCTTTGCTGACAAAGATAATTACTTC
TGTTAAATTTGCCATAACATACTCTGGTAACCAGTAAGTTGCAATCATTGCAGTAAAATT
TACTGTAGAGATTGCTTGAGTCGTTGGGTTGATTAATACTCTACCTGTCCAACTTGTAGA
GACAGATTTGAATTGAAGAAAGTTGATAAATCAATTACAAATAACCTCTCTAAGCTTGTC
TTTATTTGCAATGCTCAAAGTAGTGGCTGCACTGAATTTATAAATTATGATTCACTTTTA
AAGCATCAAAATACATGCTTGTATTAATCTCTACATTGTCCTAATATTGGTTGTGATTTC
TAATCCATTCGCAAAGAAATGGTTGACCATGAGAAAATTTGTCCTCACTATTAGCTAAAA
TGTAAATGGTGTGAGAGATCTATTAAGAGAATGAATGAGGTTTAGCATGACCTTATATGT
GAAATGAAAAAATTAGGGTGCGAAAACGAAGGATGCTAAATCACTTTAACTAGAGCAGAA
ATGAACATTCATATTTAGGAATGTCCATACAATATTTAGAAATGCAATTTATGTAACCAA
GAATTTAAACTAAAGGATCTTGCTAGACATTAAGAATGCTGTGATTTCAAAATAGAATAA
TGCAAAGGTTGTAAACAGAGTATGTATAAAAAATAGATTGTTTAGCATGAAGAAAACTGT
GAAGAAGTAGAGTTGATATGTCCTGACTGCACAGATGTTATACAAAGAAAAAACCTAGCC
AGTCACGATCAAATAACTTGTTTGAAAAGAGGTTAAAAAATTCTATTAGAAGCTAAAACT
CAATTATAATGCGAAAATGCTTGTCTAAAGAAAGACATAGAAACATTAAAACTATGTGTT
GCCTAACTCTATTCTGAGATCTAAGATATAGCCTCAGATAAGCATGAAAAAAGAAATTCT
ATGATGAAAATTTTAAGACCTCAATAATGA


>TTHERM_00877070(protein)
MNPIRQIQNQYGSPSQPSQTQPQPQSFYQNNFSPQHQIQPQQVILQQQLNINHQRASFPP
PPIIQPQNYFPLFPSLNQTPTQQQFQQQRGFVIPHREANTSIFTMAEVQERPESLEQNNL
KNMQEFMNFIDTFADKDNYFCQICHNILWQPVSCNHCSKIYCRDCLSRWVDQYSTCPTCR
DRFELKKVDKSITNNLSKLVFICNAQSSGCTEFINYDSLLKHQNTCLYQSLHCPNIGCDF
QSIRKEMVDHEKICPHYQLKCKWCERSIKRMNEVQHDLICEMKKLGCENEGCQITLTRAE
MNIHIQECPYNIQKCNLCNQEFKLKDLARHQECCDFKIEQCKGCKQSMYKKQIVQHEENC
EEVELICPDCTDVIQRKNLASHDQITCLKRGQKILLEAKTQLQCENACLKKDIETLKLCV
AQLYSEIQDIASDKHEKRNSMMKILRPQQ


>TTHERM_00877070(gene)
ATGAATCCAATAAGGTAAATTCAAAATCAATATGGATCTCCTAGTTAGCCCTCGCAAACC
TAGCCATAGCCTTAGTCATTTTATTAGAATAATTTTTCTCCTCAGCATTAAATCTAACCT
TAGCAAGTAATTTTACAGCAACAATTAAATATAAATCATCAGAGAGCAAGTTTTCCTCCT
CCACCAATTATTTAACCTTAGAATTACTTTCCTCTTTTTCCATCTTTAAACCAGACTCCA
ACTTAGCAGTAATTTTAACAACAAAGAGGATTTGTTATTCCTCACAGGTATTTTCTAAGC
TTTACATTTATTTTATTTCAAATTAAACAAACTGAGTTAGTTAAATCACTCAAACTCAGA
AATACATTAAAATATATAGAGAAGCAAATACATCTATTTTCACTATGGCAGAAGTGTAAG
AAAGGCCTGAGTCTCTAGAATAAAACAATTTAAAGAATATGCAAGAATTCATGAATTTCA
TAGATACCTTTGCTGACAAAGATAATTACTTCTGTTAAATTTGCCATAACATACTCTGGT
AACCAGTAAGTTGCAATCATTGCAGTAAAATTTACTGTAGAGATTGCTTGAGTCGTTGGG
TTGATTAATACTCTACCTGTCCAACTTGTAGAGACAGATTTGAATTGAAGAAAGTTGATA
AATCAATTACAAATAACCTCTCTAAGCTTGTCTTTATTTGCAATGCTCAAAGTAGTGGCT
GCACTGAATTTATAAATTATGATTCACTTTTAAAGCATCAAAATACATGCTTGTATTAAT
CTCTACATTGTCCTAATATTGGTTGTGATTTCTAATCCATTCGCAAAGTAATATTGCAAC
AAAAATAAAAATTGATTTGCTCAAGCAAAATATTTTACATTTCATACAAATATTTTTCTA
TTCTAACTTAAATGTTAATTTGAAGAATTTGAGTTATTCATTTCTTAATTCACAAAAATG
GTGTTTATTTATTATAAGTTATCTATTTTATTTATTGCCATTATCTTTTACTGATAATAT
AAATCTTTTCTTATTAACTTTATCTAATAAATAAATACCCATTTTTCAATTATTCTTAAT
TATTTATTTAATTCTTGATCAATTACAAAATATTTTTATAAATTTAAGAAAAATGTATTA
TAAATTATTATGAAAAAATATTTACAATATTAATTAGGAAATGGTTGACCATGAGAAAAT
TTGTCCTCACTATTAGCTAAAATGTAAATGGTGTGAGAGATCTATTAAGAGAATGAATGA
GGTTTAGCATGACCTTATATGTGAAATGAAAAAATTAGGGTGCGAAAACGAAGGATGCTA
AATCACTTTAACTAGAGCAGAAATGAACATTCATATTTAGGAATGTCCATACAATATTTA
GAAATGCAATTTATGTAACCAAGAATTTAAACTAAAGGATCTTGCTAGACATTAAGAATG
CTGTGATTTCAAAATAGAATAATGCAAAGGTTGTAAACAGAGTATGTATAAAAAATAGAT
TGTTTAGCATGAAGAAAACTGTGAAGAAGTAGAGTTGATATGTCCTGACTGCACAGATGT
TATACAAAGAAAAAACCTAGCCAGTCACGATCAAATAACTTGTTTGAAAAGAGGTTAAAA
AATTCTATTAGAAGCTAAAACTCAATTATAATGCGAAAATGCTTGTCTAAAGAAAGACAT
AGAAACATTAAAACTATGTGTTGCCTAACTCTATTCTGAGAGTATTTATTTTTTTACTTT
TGAATTAAATACTTAAAAATCATCTTTTAAATAAAGTCTAAGATATAGCCTCAGATAAGC
ATGAAAAAAGAAATTCTATGATGAAAATTTTAAGACCTCAATAATGA