Identifiers and Description

Gene Model Identifier

TTHERM_00865240

Standard Name

None

Aliases

PreTt29154 | 154.m00112 | 3751.m00458

Description

DNA ligase I, ATP-dependent

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19691.19.99709313703352e-262DNA ligase I, ATP-dependen...
OxytrichaContig10223.0.1.g272.99978794922204e-71ATP dependent DNA ligase domai
n
TAIRAT1G081301.99957647103994e-58DNA ligase / polydeoxyribonucl
eotide synthase (ATP)
IPI(HUMAN)IPI:IPI00219841.62.99921413892506e-57 PROT:P18858|TREMBL:Q2TB12;Q32
P23;Q59HG7;Q76GR4|ENSEMBL:E NS
P00000263274|REFSEQ:NP_000225|
VEGA:OTTHUMP00000077187 Tax_Id
=9606 DNA ligase 1
FlyBaseFBgn00349221.99923620009792e-56
ToxoDB25.m018208.99586662241984e-56Toxoplasma gondii DNA ligase 1
precursor, putative
PlasmoDBMAL13P1.223.99954304031399e-55Plasmodium falciparum 22
ParameciumDBGSPATP000267070014.99871117732699e-55Paramecium tetraurelia GSPATP0
0026707001 protein
CryptoDBEAK889729.99595103671115e-55Cryptosporidium parvum (Iowa)
protein EAK88972
SGDYDL164C4.99786053911152e-53CDC9 SGDID:S000002323, Chr IV
from 167255-164988, reverse co
mplement, Verified ORF, "DNA l
igase found in the nucleus and
mitochondria, an essential en
zyme that joins Okazaki fragme
nts during DNA replication; al
so acts in nucleotide excision
repair, base excision repair,
and recombination"
DictyBaseDDB02322656.0015029449437e-53lig1 DNA ligase I
DictyBaseDDB01677036.0015029449437e-53lig1 DNA ligase I
WormBaseC29A12.3a1.99938521878112e-51WBGene00002985 lig-1 DNA ligas
e I

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865240(coding)
ATGATAAAGAAATTATTGTATTTACCCAAGTAAAGCTTGTTATCATCTTTGATTTTTTCT
AAGTTTTGTACTCAATTTAACTCCAAATCTATTTAGAGCTTTTATTTTTTGGCTAAATAG
TTTGACGATATCTCCAAAATATCTTCTAGAAATTCTGGAATAGAAGCTATAGAAACTTTG
ATGAATGATTACATTTAAGGAGGAGATAATGAACTATTTATCTAAATGGTACGCTTACTA
ACCTGCAAAGTAGATAGTGAAGAAATATAAATAGCTAATTCTTCCTTAGTTGAGATATTG
AAAGTTGTATATCCCTAAGAGGATATAACTAAATTCCTTTTTGAAAAAGGAGATATAGGA
TTGTATGCAAAAGAAATGCTTGAAAAAAAACTTGAAAAAGAAGGAAATAATCGAACTGAA
AAAAATCATTTAAGTATTTTAGAAGTTACGAGCTTTTTTGAAAAACTGAAGAATTTATAA
GGTGATCGCTCGAGACTTGAAAAGCAAGAACTTATCATAGATTTTTTGAAGAAAATCTAA
GATCCACTTGAAATATAATATTTTATCAGAATCCTTTCTAAAAGCCTAAGGATAGGTGTA
AGTGAGAAATCTATTATAAAAGCATTAACAAATATCAATAAAAAGAAGAAAAACTCTTTG
GATTCACTGCTTAAAAATGTTCAAGATAAAATATTTGGATATAATACTGCCTTACATACC
GATATTTAAATAGGAACTCCTGTGCCTCCAATGCTAGCCAAACCAGTTTCCGATTTTGAC
GAACTTTTAAAATTTTTAAAGAAGTACGAAAGTAAAAAAGTCTCTCTTGAACTAAAATAT
GATGGAGAGAGATGTTAGGTTCATTATGGTAAAAAGAAAGGAATTAAATTATTTAGTAGA
AATTTAGAAATCTAAAATGAGAAATATCCATAACTAGTTTAGCAATTAGAAAAATATTTT
TAGAAAAATAACAGTGTAGAAGATTGCATATTAGATGGAGAGATTGTTGTAACAGATTCT
AAAGGAAATATTAAATCATTTTAAGAACAACAACAAAATAGAAAAAGGAAATAAGATTCT
AACAAGGTAGTTGCTTTCGATGAAGATAATATTGAAAAGATTTACTTATTTGATATCCTG
TTTTTAAATGCATGTGAGCAAAATACCAAGGAATAACTTTACAGAAAGAGCTTGATTAAA
GAAAATTTTCCTATTGAAGGACCAGTTAATCACGCTGAATCAAAAATATTTGATCTTAGC
ATATAAAAAGATTTTGATGAGCTAAAAAAATTAGTAAAATAATATATTGATTAAAAAGAA
GAAGGTGCTATGGTTAAATCGCTTGATTCTAATACATTTTATGATAATAATGGAAGAACT
TAGTGGGCAAAATTAAAGAAGCAAGTTTTGTCAGGAGGTTTAGCTGATACATTTGATGTT
ATTCCTATTGCTGCATACTATGGAAAAGGCAAGAGATCTGGTGTCTATGGATCATATCTA
CTTGCTTGTTATGATGACAAAAAGAAAGAGTATGTGGCTTTGTGTAAGATAGGTACAGGT
TTTTCTGATCAATTTTTATAAGATTCAACGGATAGACTGAAATAAAAAGTATGCAGTTAA
AAACCTAAAGAATACTCTGTGCATAGAACTTTTAAGCCTGATGTTTGGTTTTAAAAAGAT
GCTGAAGTGTGGGAAGTAGAGAGTGATAGTCTTTCATCATCTCCTATTTATACAATAGGA
AAAATGAATTATAGTGATAATGGAATATCCCTTCGTTTCCCAAGATTCTTACGTGTAAGA
GATGATAAAACTACTGAACAATCAACAAAAACATATTAAAATAATTCAAAAGATTAAAAA
GGAGACCATGGAGATAAAGGAGAAGAAGAAGAAGAAGGAGATAAGTGA


>TTHERM_00865240(protein)
MIKKLLYLPKQSLLSSLIFSKFCTQFNSKSIQSFYFLAKQFDDISKISSRNSGIEAIETL
MNDYIQGGDNELFIQMVRLLTCKVDSEEIQIANSSLVEILKVVYPQEDITKFLFEKGDIG
LYAKEMLEKKLEKEGNNRTEKNHLSILEVTSFFEKLKNLQGDRSRLEKQELIIDFLKKIQ
DPLEIQYFIRILSKSLRIGVSEKSIIKALTNINKKKKNSLDSLLKNVQDKIFGYNTALHT
DIQIGTPVPPMLAKPVSDFDELLKFLKKYESKKVSLELKYDGERCQVHYGKKKGIKLFSR
NLEIQNEKYPQLVQQLEKYFQKNNSVEDCILDGEIVVTDSKGNIKSFQEQQQNRKRKQDS
NKVVAFDEDNIEKIYLFDILFLNACEQNTKEQLYRKSLIKENFPIEGPVNHAESKIFDLS
IQKDFDELKKLVKQYIDQKEEGAMVKSLDSNTFYDNNGRTQWAKLKKQVLSGGLADTFDV
IPIAAYYGKGKRSGVYGSYLLACYDDKKKEYVALCKIGTGFSDQFLQDSTDRLKQKVCSQ
KPKEYSVHRTFKPDVWFQKDAEVWEVESDSLSSSPIYTIGKMNYSDNGISLRFPRFLRVR
DDKTTEQSTKTYQNNSKDQKGDHGDKGEEEEEGDK


>TTHERM_00865240(gene)
ATGATAAAGAAATTATTGTATTTACCCAAGTAAAGCTTGTTATCATCTTTGATTTTTTCT
AAGTTTTGTACTCAATTTAACTCCAAATCTATTTAGAGCTTTTATTTTTTGGCTAAATAG
TTTGACGATATCTCCAAAATATCTTCTAGAAATTCTGGAATAGAAGCTATAGAAACTTTG
ATGAATGATTACATTTAAGGAGGAGATAATGAAGTAAATAAAACCAATTAAAATTGTAAC
TAAACATTCAAAATATTAACTAGCTATTTATCTAAATGGTACGCTTACTAACCTGCAAAG
TAGATAGTGAAGAAATATAAATAGCTAATTCTTCCTTAGTTGAGATATTGAAAGTTGTAT
ATCCCTAAGAGGATATAACTAAATTCCTTTTTGAAAAAGGAGATATAGGATTGTATGCAA
AAGAAATGCTTGAAAAAAAACTTGAAAAAGAAGGAAATAATCGAACTGAAAAAAATCATT
TAAGTATTTTAGAAGTTACGAGCTTTTTTGAAAAACTGAAGAATTTATAAGGTGATCGCT
CGAGACTTGAAAAGCAAGAACTTATCATAGATTTTTTGAAGAAAATCTAAGATCCACTTG
AAATATAATATTTTATCAGAATCCTTTCTGTAAATTTTTGTTGAAATTAAATGTAAAAAG
TAAATAATTTATATCTTAGAAAAGCCTAAGGATAGGTGTAAGTGAGAAATCTATTATAAA
AGCATTAACAAATATCAATAAAAAGAAGAAAAACTCTTTGGATTCACTGCTTAAAAATGT
TCAAGATAAAATATTTGGATATAATACTGCCTTACATACCGATATTTAAATAGGAACTCC
TGTGCCTCCAATGCTAGCCAAACCAGTTTCCGATTTTGACGAACTTTTAAAATTTTTAAA
GAAGTACGAAAGTAAAAAAGTCTCTCTTGAACTAAAATATGATGGAGAGAGATGTTAGGT
AAATATTAAGATAAAATAAGAGTTAATGTTTTTACTTTTAAATAAAAGGTTCATTATGGT
AAAAAGAAAGGAATTAAATTATTTAGTAGAAATTTAGAAATCTAAAATGAGAAATATCCA
TAACTAGTTTAGCAATTAGAAAAATATTTTTAGAAAAATAACAGTGTAGAAGATTGCATA
TTAGATGGAGAGATTGTTGTAACAGATTCTAAAGGAAATATTAAATCATTTTAAGAACAA
CAACAAAATAGAAAAAGGAAATAAGATTCTAACAAGGTAGTTGCTTTCGATGAAGATGTA
ATTTTAATCCTTAAATATAAAAAATTGTCTAAATTTTTAATTAAAATAAATGTTAGAATA
TTGAAAAGATTTACTTATTTGATATCCTGTTTTTAAATGCATGTGAGCAAAATACCAAGG
AATAACTTTACAGAAAGAGCTTGATTAAAGAAAATTTTCCTATTGAAGGACCAGTTAATC
ACGCTGAATCAAAAATATTTGATCTTAGCATATAAAAAGATTTTGATGAGCTAAAAAAAT
TAGTAAAATAATATATTGATTAAAAAGAAGAAGGTGCTATGGTTAAATCGCTTGATTCTA
ATACATTTTATGATAATAATGGAAGAACTTAGTGGGCAAAATTAAAGAAGCAAGTTTTGT
CAGGAGGTTTAGCTGATACATTTGATGTTATTCCTATTGCTGCATACTATGGAAAAGGCA
AGAGGTAATAATTAGTTAGCTAATTTTATAATTCTAGAAAAAATTAACTTAATAAAAATA
AATAAGATCTGGTGTCTATGGATCATATCTACTTGCTTGTTATGATGACAAAAAGAAAGA
GTATGTGGCTTTGTGTAAGATAGGTACAGGTTTTTCTGATCAATTTTTATAAGATTCAAC
GGATAGACTGAAATAAAAAGTATGCAGTTAAAAACCTAAAGAATACTCTGTGCATAGAAC
TTTTAAGCCTGATGTTTGGTTTTAAAAAGATGCTGAAGTGTGGGAAGTAGAGAGTGATAG
TCTTTCATCATCTCCTATTTATACAATAGGAAAAATGAATTATAGTGATAATGGAATATC
CCTTCGTTTCCCAAGATTCTTACGTGTAAGAGATGATAAAACTACTGAACAATCAACAAA
AACATATTAAGTATATTTAAATTATTAAATTAAAATAAAAAAATTAAAATCTATTAATTT
AATTTAAAAAAGATTATTGAGTTCTACAATAAATAATAAGCAAAACCAAATGTAATTAAT
TCATTTTTGAGTTAAAATAATACCTAACAAATTTATTCACATTATTTTTTAGAATAATTC
AAAAGATTAAAAAGGAGACCATGGAGATAAAGGAGAAGAAGAAGAAGAAGGAGATAAGTG
A