Identifiers and Description

Gene Model Identifier

TTHERM_00865240

Standard Name

None

Aliases

PreTt29154 | 154.m00112 | 3751.m00458

Description

DNA ligase I, ATP-dependent

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19691.19.997093137033517e-262DNA ligase I, ATP-dependent (6
50 aa)
DictyBaseDDB_G02744935.999713922843926e-73lig1 on chromosome: 2 position
4400712 to 4404415
WormBaseWBGene000029857.997481627602355e-72locus:lig-1 DNA ligase 1 s
tatus:Partially_confirmed Un
iProt:Q27474 protein_id:CAA9
8242.2
OxytrichaContig10223.0.1.g279.995417076252815e-72ATP dependent DNA ligase domai
n
SGDYDL164C9.999565105288807e-71CDC9 DNA ligase found in the n
ucleus and mitochondria, an es
sential enzyme that joins Okaz
aki fragments during DNA repli
cation; also acts in nucleotid
e excision repair, base excisi
on repair, and recombination

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00865240(coding)
ATGATAAAGAAATTATTGTATTTACCCAAGTAAAGCTTGTTATCATCTTTGATTTTTTCT
AAGTTTTGTACTCAATTTAACTCCAAATCTATTTAGAGCTTTTATTTTTTGGCTAAATAG
TTTGACGATATCTCCAAAATATCTTCTAGAAATTCTGGAATAGAAGCTATAGAAACTTTG
ATGAATGATTACATTTAAGGAGGAGATAATGAACTATTTATCTAAATGGTACGCTTACTA
ACCTGCAAAGTAGATAGTGAAGAAATATAAATAGCTAATTCTTCCTTAGTTGAGATATTG
AAAGTTGTATATCCCTAAGAGGATATAACTAAATTCCTTTTTGAAAAAGGAGATATAGGA
TTGTATGCAAAAGAAATGCTTGAAAAAAAACTTGAAAAAGAAGGAAATAATCGAACTGAA
AAAAATCATTTAAGTATTTTAGAAGTTACGAGCTTTTTTGAAAAACTGAAGAATTTATAA
GGTGATCGCTCGAGACTTGAAAAGCAAGAACTTATCATAGATTTTTTGAAGAAAATCTAA
GATCCACTTGAAATATAATATTTTATCAGAATCCTTTCTAAAAGCCTAAGGATAGGTGTA
AGTGAGAAATCTATTATAAAAGCATTAACAAATATCAATAAAAAGAAGAAAAACTCTTTG
GATTCACTGCTTAAAAATGTTCAAGATAAAATATTTGGATATAATACTGCCTTACATACC
GATATTTAAATAGGAACTCCTGTGCCTCCAATGCTAGCCAAACCAGTTTCCGATTTTGAC
GAACTTTTAAAATTTTTAAAGAAGTACGAAAGTAAAAAAGTCTCTCTTGAACTAAAATAT
GATGGAGAGAGATGTTAGGTTCATTATGGTAAAAAGAAAGGAATTAAATTATTTAGTAGA
AATTTAGAAATCTAAAATGAGAAATATCCATAACTAGTTTAGCAATTAGAAAAATATTTT
TAGAAAAATAACAGTGTAGAAGATTGCATATTAGATGGAGAGATTGTTGTAACAGATTCT
AAAGGAAATATTAAATCATTTTAAGAACAACAACAAAATAGAAAAAGGAAATAAGATTCT
AACAAGGTAGTTGCTTTCGATGAAGATAATATTGAAAAGATTTACTTATTTGATATCCTG
TTTTTAAATGCATGTGAGCAAAATACCAAGGAATAACTTTACAGAAAGAGCTTGATTAAA
GAAAATTTTCCTATTGAAGGACCAGTTAATCACGCTGAATCAAAAATATTTGATCTTAGC
ATATAAAAAGATTTTGATGAGCTAAAAAAATTAGTAAAATAATATATTGATTAAAAAGAA
GAAGGTGCTATGGTTAAATCGCTTGATTCTAATACATTTTATGATAATAATGGAAGAACT
TAGTGGGCAAAATTAAAGAAGCAAGTTTTGTCAGGAGGTTTAGCTGATACATTTGATGTT
ATTCCTATTGCTGCATACTATGGAAAAGGCAAGAGATCTGGTGTCTATGGATCATATCTA
CTTGCTTGTTATGATGACAAAAAGAAAGAGTATGTGGCTTTGTGTAAGATAGGTACAGGT
TTTTCTGATCAATTTTTATAAGATTCAACGGATAGACTGAAATAAAAAGTATGCAGTTAA
AAACCTAAAGAATACTCTGTGCATAGAACTTTTAAGCCTGATGTTTGGTTTTAAAAAGAT
GCTGAAGTGTGGGAAGTAGAGAGTGATAGTCTTTCATCATCTCCTATTTATACAATAGGA
AAAATGAATTATAGTGATAATGGAATATCCCTTCGTTTCCCAAGATTCTTACGTGTAAGA
GATGATAAAACTACTGAACAATCAACAAAAACATATTAAATTATTGAGTTCTACAATAAA
TAATAAGCAAAACCAAATAATAATTCAAAAGATTAAAAAGGAGACCATGGAGATAAAGGA
GAAGAAGAAGAAGAAGGAGATAAGTGA


>TTHERM_00865240(protein)
MIKKLLYLPKQSLLSSLIFSKFCTQFNSKSIQSFYFLAKQFDDISKISSRNSGIEAIETL
MNDYIQGGDNELFIQMVRLLTCKVDSEEIQIANSSLVEILKVVYPQEDITKFLFEKGDIG
LYAKEMLEKKLEKEGNNRTEKNHLSILEVTSFFEKLKNLQGDRSRLEKQELIIDFLKKIQ
DPLEIQYFIRILSKSLRIGVSEKSIIKALTNINKKKKNSLDSLLKNVQDKIFGYNTALHT
DIQIGTPVPPMLAKPVSDFDELLKFLKKYESKKVSLELKYDGERCQVHYGKKKGIKLFSR
NLEIQNEKYPQLVQQLEKYFQKNNSVEDCILDGEIVVTDSKGNIKSFQEQQQNRKRKQDS
NKVVAFDEDNIEKIYLFDILFLNACEQNTKEQLYRKSLIKENFPIEGPVNHAESKIFDLS
IQKDFDELKKLVKQYIDQKEEGAMVKSLDSNTFYDNNGRTQWAKLKKQVLSGGLADTFDV
IPIAAYYGKGKRSGVYGSYLLACYDDKKKEYVALCKIGTGFSDQFLQDSTDRLKQKVCSQ
KPKEYSVHRTFKPDVWFQKDAEVWEVESDSLSSSPIYTIGKMNYSDNGISLRFPRFLRVR
DDKTTEQSTKTYQIIEFYNKQQAKPNNNSKDQKGDHGDKGEEEEEGDK


>TTHERM_00865240(gene)
AAAAAATATTTTTTTTTGAAAAAAGACTTAATTAAAATTAAATTAAATTTTATAATAATT
AGAATTTAGATTTGGGCATAGTTTTTTTAATTTACTTATCGATCAAAAATATCCAGAACT
TTCTAAATTTCGTTTTAAAACAGATTATCTGACGAATCAATAAAAGAAAAGTAGGAATTA
AAATTATTGCTAAATTTAATACAGATGATAAAGAAATTATTGTATTTACCCAAGTAAAGC
TTGTTATCATCTTTGATTTTTTCTAAGTTTTGTACTCAATTTAACTCCAAATCTATTTAG
AGCTTTTATTTTTTGGCTAAATAGTTTGACGATATCTCCAAAATATCTTCTAGAAATTCT
GGAATAGAAGCTATAGAAACTTTGATGAATGATTACATTTAAGGAGGAGATAATGAAGTA
AATAAAACCAATTAAAATTGTAACTAAACATTCAAAATATTAACTAGCTATTTATCTAAA
TGGTACGCTTACTAACCTGCAAAGTAGATAGTGAAGAAATATAAATAGCTAATTCTTCCT
TAGTTGAGATATTGAAAGTTGTATATCCCTAAGAGGATATAACTAAATTCCTTTTTGAAA
AAGGAGATATAGGATTGTATGCAAAAGAAATGCTTGAAAAAAAACTTGAAAAAGAAGGAA
ATAATCGAACTGAAAAAAATCATTTAAGTATTTTAGAAGTTACGAGCTTTTTTGAAAAAC
TGAAGAATTTATAAGGTGATCGCTCGAGACTTGAAAAGCAAGAACTTATCATAGATTTTT
TGAAGAAAATCTAAGATCCACTTGAAATATAATATTTTATCAGAATCCTTTCTGTAAATT
TTTGTTGAAATTAAATGTAAAAAGTAAATAATTTATATCTTAGAAAAGCCTAAGGATAGG
TGTAAGTGAGAAATCTATTATAAAAGCATTAACAAATATCAATAAAAAGAAGAAAAACTC
TTTGGATTCACTGCTTAAAAATGTTCAAGATAAAATATTTGGATATAATACTGCCTTACA
TACCGATATTTAAATAGGAACTCCTGTGCCTCCAATGCTAGCCAAACCAGTTTCCGATTT
TGACGAACTTTTAAAATTTTTAAAGAAGTACGAAAGTAAAAAAGTCTCTCTTGAACTAAA
ATATGATGGAGAGAGATGTTAGGTAAATATTAAGATAAAATAAGAGTTAATGTTTTTACT
TTTAAATAAAAGGTTCATTATGGTAAAAAGAAAGGAATTAAATTATTTAGTAGAAATTTA
GAAATCTAAAATGAGAAATATCCATAACTAGTTTAGCAATTAGAAAAATATTTTTAGAAA
AATAACAGTGTAGAAGATTGCATATTAGATGGAGAGATTGTTGTAACAGATTCTAAAGGA
AATATTAAATCATTTTAAGAACAACAACAAAATAGAAAAAGGAAATAAGATTCTAACAAG
GTAGTTGCTTTCGATGAAGATGTAATTTTAATCCTTAAATATAAAAAATTGTCTAAATTT
TTAATTAAAATAAATGTTAGAATATTGAAAAGATTTACTTATTTGATATCCTGTTTTTAA
ATGCATGTGAGCAAAATACCAAGGAATAACTTTACAGAAAGAGCTTGATTAAAGAAAATT
TTCCTATTGAAGGACCAGTTAATCACGCTGAATCAAAAATATTTGATCTTAGCATATAAA
AAGATTTTGATGAGCTAAAAAAATTAGTAAAATAATATATTGATTAAAAAGAAGAAGGTG
CTATGGTTAAATCGCTTGATTCTAATACATTTTATGATAATAATGGAAGAACTTAGTGGG
CAAAATTAAAGAAGCAAGTTTTGTCAGGAGGTTTAGCTGATACATTTGATGTTATTCCTA
TTGCTGCATACTATGGAAAAGGCAAGAGGTAATAATTAGTTAGCTAATTTTATAATTCTA
GAAAAAATTAACTTAATAAAAATAAATAAGATCTGGTGTCTATGGATCATATCTACTTGC
TTGTTATGATGACAAAAAGAAAGAGTATGTGGCTTTGTGTAAGATAGGTACAGGTTTTTC
TGATCAATTTTTATAAGATTCAACGGATAGACTGAAATAAAAAGTATGCAGTTAAAAACC
TAAAGAATACTCTGTGCATAGAACTTTTAAGCCTGATGTTTGGTTTTAAAAAGATGCTGA
AGTGTGGGAAGTAGAGAGTGATAGTCTTTCATCATCTCCTATTTATACAATAGGAAAAAT
GAATTATAGTGATAATGGAATATCCCTTCGTTTCCCAAGATTCTTACGTGTAAGAGATGA
TAAAACTACTGAACAATCAACAAAAACATATTAAGTATATTTAAATTATTAAATTAAAAT
AAAAAAATTAAAATCTATTAATTTAATTTAAAAAAGATTATTGAGTTCTACAATAAATAA
TAAGCAAAACCAAATGTAATTAATTCATTTTTGAGTTAAAATAATACCTAACAAATTTAT
TCACATTATTTTTTAGAATAATTCAAAAGATTAAAAAGGAGACCATGGAGATAAAGGAGA
AGAAGAAGAAGAAGGAGATAAGTGAAAATAAATAAATCAATGAGATATGTTTATTAATGG
CAAAAAGAATTTATTTATAAAACCTTTATATTTACAATTAATATTTAATATAAAATTACT
TAATTATTTGTTTTTTTTTTTTATTTTAAACAAAAATGAGTCATTAGATTTTTTTGTTTA
AATATTTTATTTATCTTTCATTATTTCGAGAATCAGTCAGAC