Identifiers and Description

Gene Model Identifier

TTHERM_00858110

Standard Name

None

Aliases

PreTt09075 | 152.m00095

Description

zinc finger protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 52.3%

TetraMine Data

TTHERM_00858110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07200.10.00000000000006002591555650462IQ calmodulin-binding domain-c
ontaining protein family prote
in (1183 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00858110(coding)
ATGTATTAAAGAATGGTCTTAAGTAATTCCTTTATAGCATTATTATTCAGAAATCTAATA
CTTTATTTATAGAAAAAGCTACAATGCCCTCTTTGTAAAACTCACTTCATAAATGTGATA
ATTTCTAAAAGAATTTATTATGAATAAACATAATAACCACAATCTCCATAAATAACAGCT
GATGCTACTACTGCGTATCAACTTGATAATAACAGTAGCTCATTCTAAAAAGCTTATTTT
GATTAAGAAACATCGATCAGTGACGATAATAAAAATATTAGTATAGAAAAGAGTAGGAAT
CACAAGAAATAACCTAAATTCAAAATCACTAAAGAGCTAATCCGTTTGGATATAGTGATG
AAAAACGTGACAAATTAATCTTTGGGCATATCAGGGCAAACTTAAAGTTCATCTTCGTCA
TCGTCGTCTGCAATGAGCATGCATTAAATTCAGAACCTTTCAAATATATTAACCAATTAA
AATAGACCACCAATTTAATTAAATGCTCATTAACCAAGAATTATTTTTTCTTAGTAAAAT
CATCTTAATCAATAATAAATTTAGAATGAGCTATTAATAGAATAGGAAAAAATTGATAAA
ATTTTACCTCAACTTCAATAAAATGTTTAAAATAATTAGACTCTTCAGTAAAATTTACAT
CCTGATTACATTATTTAATTGATAAAAGAATTATCTAACACAGACACTTCTTAGCAAAAT
CAAAATCAAATTTCTAATCAAGCTTAACTCATGTTAAGATTACACTTATCAAATACAAGA
TTTTAACTTCTAGGATATTTATATTCAAGTCTTTTCAAATCTGACTTTGCTCTTGGAGTT
GGTAGTCATGATCCTTTATATCAACCACACAACAGTTAGTAAATAGAATAAAATTAATTA
AAAATACTTAATCAAATACCATGCTAAAGCTGGCTTCAGTTAAATAATATTCTTACTAGT
TAACTTCTTGAATAAACAATCAATCAAATTTCTTTTACTGCAAAATTCTTTAACTCTTAA
AATCCCCCTTCCAATTACTAATCCCTAGAAACTAACTTACAACTGTAACAAGGATAGCAT
TAATTATGA


>TTHERM_00858110(protein)
MYQRMVLSNSFIALLFRNLILYLQKKLQCPLCKTHFINVIISKRIYYEQTQQPQSPQITA
DATTAYQLDNNSSSFQKAYFDQETSISDDNKNISIEKSRNHKKQPKFKITKELIRLDIVM
KNVTNQSLGISGQTQSSSSSSSSAMSMHQIQNLSNILTNQNRPPIQLNAHQPRIIFSQQN
HLNQQQIQNELLIEQEKIDKILPQLQQNVQNNQTLQQNLHPDYIIQLIKELSNTDTSQQN
QNQISNQAQLMLRLHLSNTRFQLLGYLYSSLFKSDFALGVGSHDPLYQPHNSQQIEQNQL
KILNQIPCQSWLQLNNILTSQLLEQTINQISFTAKFFNSQNPPSNYQSLETNLQLQQGQH
QL


>TTHERM_00858110(gene)
ATGTATTAAAGAATGGTCTTAAGTAATTCCTTTATAGCATTATTATTCAGAAATCTAATA
CTTTATTTATAGAAAAAGCTACAATGCCCTCTTTGTAAAACTCACTTCATAAATGTGATA
ATTTCTAAAAGAATTTATTATGAATAAACATAATAACCACAATCTCCATAAATAACAGCT
GATGCTACTACTGCGTATCAACTTGATAATAACAGTAGCTCATTCTAAAAAGCTTATTTT
GATTAAGAAACATCGATCAGTGACGATAATAAAAATATTAGTATAGAAAAGAGTAGGAAT
CACAAGAAATAACCTAAATTCAAGTAAAAAAATTTTTCTGGCAATTTTAATAAAATTCAG
TTCATTTCATCAAAAATTAAAAAAAATTAACTTACTTCAAAAGAAACTTCTTACTTTTTT
TAATTTTTTTTACACTGTACCAAAAAACTAAATTTCCTCGAAACATAACAAACAAACAAA
TAATACCATTTAAAATGCAAAGCTTATTTAATTTACACTAAATTCTTATAAAAAATATCT
GACTCAACTGCATGCATTTATTTACTATATTTTTACTCAAATATAAAATAGAATCACTAA
AGAGCTAATCCGTTTGGATATAGTGATGAAAAACGTGACAAATTAATCTTTGGGCATATC
AGGGCAAACTTAAAGTTCATCTTCGTCATCGTCGTCTGCAATGAGCATGCATTAAATTCA
GAACCTTTCAAATATATTAACCAATTAAAATAGACCACCAATTTAATTAAATGCTCATTA
ACCAAGAATTATTTTTTCTTAGTAAAATCATCTTAATCAATAATAAATTTAGAATGAGCT
ATTAATAGAATAGGAAAAAATTGATAAAATTTTACCTCAACTTCAATAAAATGTTTAAAA
TAATTAGACTCTTCAGTAAAATTTACATCCTGATTACATTATTTAATTGATAAAAGAATT
ATCTAACACAGACACTTCTTAGCAAAATCAAAATCAAATTTCTAATCAAGCTTAACTCAT
GTTAAGATTACACTTATCAAATACAAGATTTTAACTTCTAGGATATTTATATTCAAGTCT
TTTCAAATCTGACTTTGCTCTTGGAGGTAAAAACTTATATAAAATCTTATATTTCATTCA
TTCTTTACTAATTTTTTATAATACACTTAAAAACTGATTTCTACAGCTTACATAAAAATT
AGAATTCAAAAGAAAAAATAAATACTCTTACACTTCAATATTTAAGCTTTTATTAATTAA
TAAATAAATAAATAAATTAGTTGGTAGTCATGATCCTTTATATCAACCACACAACAGTTA
GTAAATAGAATAAAATTAATTAAAAATACTTAATCAAATACCATGCTAAAGCTGGCTTCA
GTTAAATAATATTCTTACTAGTTAACTTCTTGAATAAACAATCAATCAAATTTCTTTTAC
TGCAAAATTCTTTAACTCTTAAAATCCCCCTTCCAATTACTAATCCCTAGAAACTAACTT
ACAACTGTAACAAGGATAGCATTAATTATGA