Identifiers and Description

Gene Model Identifier

TTHERM_00849250

Standard Name

None

Aliases

PreTt24926 | 149.m00052 | 3750.m00282

Description

kelch motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00849250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18704.19.997093137033517e-262kelch domain-containing protei
n family protein (644 aa)
OxytrichaContig20663.0.g918.996157222146379e-27Kelch motif
DictyBaseDDB_G02713720.000000000003001226732525078DDB_G0271372 on chromosome: 2
position 117705 to 120704
WormBaseWBGene000209520.000000000040005666873964816locus:kel-8 Kelch-like prote
in 8 status:Confirmed UniP
rot:G5ED84 protein_id:CCD742
70.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00849250(coding)
ATGAGTAGGATACTTTCAAGGGAAGATGAGAATTCATATAAAGAATCTTAGCAAATGATA
ACATCAATAACGAGAAATATACGCCCTGTTAAGTGTAAGGACCATCAAGAAGAAAATTAT
ACTAATTTTTGCATGAGTAAAGATTGTATGAGAGCACTTTGTCCTGATTGTATGGAAAGG
CATACATAATTCCATAAGTAAAATAGTACTTATCCTGACCTTTAGTCTATTAAGAGCGTT
AAGGTTAAGTGCAAATAAAAATTAATGGAAATCAAAAACAATATAGATTAACTCTACGAT
TAGATTGAAGATTTAATTTAAAATTAGAATTTAGATGAGTCTGATGAAGGTATAAAAAAG
ATAAATACTGTTAGAGATACTATAATATATTAGGTTAATAGCTACTTTGATCAGCTTTTA
GATAAATATAGGGCTAGAGTTTCTGCTATGATTGAAAAAGACGAAAAAATCAAGTATATC
TAAGATAGGTTATCATTAATGTCTGATGAAATAGAGATAATGTCTGCAAAAATGGAGGGT
ACCGCTGCTTAAATCGATGCTTTCAACGAAGTATAAAATTTAGATTTAAATGGATAGCTG
AATGATATAGAAATTTAAGTTTAGGATATCTTGAATATATAATAACGTTAATCTATTGAT
ATTATTGTTGAAGAAAGCAAAATTAGAATGTTAAAAACAGATTTGGTTTAATATATACGG
TTAGGTTAATACATATTCTATGATTAATAAGAATAACTAAATTAACAAGCTATAAGCTAA
CCTCAACAATCACTAATTGCAAATCAGTCACCAATTTAAGAGAATAAGAGTAAATATCAA
GAGGAAATTAATACAAGCTTTCCAGACCATGTAGATACTGATCCTAGTTTTGATAATAAA
TATATGTAAAGTAATTAGAACTCATTTTATGCTGCTGATGAATCTTAAATTGCTTAAATA
GAAATTAATTAAAACAGCTATTATGAGAGTGGTTGTCCTCATAAAATAATACCTTATTAT
AATTACTAGAATAAAAAACTTTATATGATAGATGCAACTACTTTTGAACTTAGAAATGAA
GTATCTATCAATGAATTTATAGCAGATTAAGGTAGAACAGTCATAACACCTAGAGGAGAT
ATCTATATGATTGGAGGAATCTTAAGAAATAGTGATACTGAAAAGGTTTTTAAATATGAT
TATACAGAAGAAAAATTTACTGAAAGATAAAGTATGATTTATGCTAGAAGCTCTTTTGCT
GCTGTTTATGTCGACAAATTCATATATGTTATTGGAGGTAAAAGAGATGGATTAGCATGT
TCTGAGTGTGAAAAATATGATCTAGTACAAAATAAATGGAAAGCTATTGCAAATCTAAAC
TACTCAGCTTTTTCATCTTCAGTTTGCACTTTTGGAAATAATTACTTATATAAATTTGGT
GGAATAGGACCAGGCTAAGTGTAAAATAATAACTATGTTGAACGTTATGACATTTAGTAG
AATTATTGGTAAATAATAAATTTAATGCATGAAGACATTACAGGAATTCATAGCATAGGA
CCTTAAAAAATGTTTGCCCTATTCTTTAACAGTGGAGCTATTTAGATAAATGATTCCACT
ATCTTTGTATTTGGAGGATAGCTAGAAAAGAAAATGTAAAAATCAAGCTTTTGTTTTAAT
ATCAAAAAAGAAAAAACCAACAATTAATAAAATATAATGCATGTTTTAAACAGATTTGAC
TACATCCCTCTACCTTCAGCTGGTTCTTTTACATCAAACCCAATAATTCACAATAACAAG
ATAATATGTTTATAAAATATTGATAACTCTGTTGGGTAAGGATAAAGTTCAATTTACAGT
AAAAAGAAATTACTTGTATTTGATGGAACTAATTGGATAGAAACTATATACAATTTCAAT
TGA


>TTHERM_00849250(protein)
MSRILSREDENSYKESQQMITSITRNIRPVKCKDHQEENYTNFCMSKDCMRALCPDCMER
HTQFHKQNSTYPDLQSIKSVKVKCKQKLMEIKNNIDQLYDQIEDLIQNQNLDESDEGIKK
INTVRDTIIYQVNSYFDQLLDKYRARVSAMIEKDEKIKYIQDRLSLMSDEIEIMSAKMEG
TAAQIDAFNEVQNLDLNGQLNDIEIQVQDILNIQQRQSIDIIVEESKIRMLKTDLVQYIR
LGQYIFYDQQEQLNQQAISQPQQSLIANQSPIQENKSKYQEEINTSFPDHVDTDPSFDNK
YMQSNQNSFYAADESQIAQIEINQNSYYESGCPHKIIPYYNYQNKKLYMIDATTFELRNE
VSINEFIADQGRTVITPRGDIYMIGGILRNSDTEKVFKYDYTEEKFTERQSMIYARSSFA
AVYVDKFIYVIGGKRDGLACSECEKYDLVQNKWKAIANLNYSAFSSSVCTFGNNYLYKFG
GIGPGQVQNNNYVERYDIQQNYWQIINLMHEDITGIHSIGPQKMFALFFNSGAIQINDST
IFVFGGQLEKKMQKSSFCFNIKKEKTNNQQNIMHVLNRFDYIPLPSAGSFTSNPIIHNNK
IICLQNIDNSVGQGQSSIYSKKKLLVFDGTNWIETIYNFN


>TTHERM_00849250(gene)
ATGAGTAGGATACTTTCAAGGGAAGATGAGAATTCATATAAAGAATCTTAGCAAATGATA
ACATCAATAACGAGAAATATACGCCCTGTTAAGTGTAAGGACCATCAAGAAGAAAATTAT
ACTAATTTTTGCATGAGTAAAGATTGTATGAGAGCACTTTGTCCTGATTGTATGGAAAGG
CATACATAATTCCATAAGTAAAATAGTACTTATCCTGACCTTTAGTCTATTAAGAGCGTT
AAGGTTAAGTGCAAATAAAAATTAATGGAAATCAAAAACAATATAGATTAACTCTACGAT
TAGATTGAAGATTTAATTTAAAATTAGAATTTAGATGAGTCTGATGAAGGTATAAAAAAG
ATAAATACTGTTAGAGATACTATAATATATTAGGTTAATAGCTACTTTGATCAGCTTTTA
GATAAATATAGGGCTAGAGTTTCTGCTATGATTGAAAAAGACGAAAAAATCAAGTATATC
TAAGATAGGTTATCATTAATGTCTGATGAAATAGAGATAATGTCTGCAAAAATGGAGGGT
ACCGCTGCTTAAATCGATGCTTTCAACGAAGTAAATTCTTAATTTAATTTAGCATAATAA
ATAAATAGCTAGTTAAATGAATTTAATCTAAAATCATAATTTAAAGTTTATAATTTAAAA
ATATTTAATCTACTATTAAGATTAAAAAGAAAATTAATTTTACATAGCAAGTATCTATAT
AAAGATTTAAGATGCTACAAAAATAAATAAAATTATAATTCAAATCAACATAAAATTAGT
TTTTAAAAAATAAAATATTTAAATAGAATAAAATTAAATAAAATTTTTTAATAAATAATA
TCTAAAAATTTTATTTTTTTTACTGTAGGTATAAAATTTAGATTTAAATGGATAGCTGAA
TGATATAGAAATTTAAGTTTAGGATATCTTGAATATATAATAACGTTAATCTATTGATAT
TATTGTTGAAGAAAGCAAAATTAGAATGTTAAAAACAGATTTGGTTTAATATATACGGTT
AGGTTAATACATATTCTATGATTAATAAGAATAACTAAATTAACAAGCTATAAGCTAACC
TCAACAATCACTAATTGCAAATCAGTCACCAAGTAAATTATTTCTTACAAAAATAAATTA
AAAAAATTATCTTTTTTCAATAGTTTATTTAACAAAACAGTTTATTTTATTTTAAAAATA
CAAATTTTAATTTCTAAGACTAAATTGTTGAATTAGATAAAAAATTTTTTTGTTAATAAA
AAATAATAGAAAGGATTTTTTTAATTTAAATTTTAATAAAAGAATTAATTAAATAAAATA
TTTTAATTATTTACTAATTTGATTAAAGCAATAATAAATTCATGCATTTAATTAATTAAT
TTTATATGTCTTTATTTATCTGAATATTAAAATTTAAAAAAATAATAAAATAGTTTAAGA
GAATAAGAGTAAATATCAAGAGGAAATTAATACAAGCTTTCCAGACCATGTAGATACTGA
TCCTAGTTTTGATAATAAATATATGTAAAGTAATTAGAACTCATTTTATGCTGCTGATGA
ATCTTAAATTGCTTAAATAGAAATTAATTAAAACAGCTATTATGAGAGTGGTTGTCCTCA
TAAAATAATACCTTATTATAATTACTAGAATAAAAAACTTTATATGATAGATGCAACTAC
TTTTGAACTTAGAAATGAAGTATCTATCAATGAATTTATAGCAGATTAAGGTAGAACAGT
CATAACACCTAGAGGAGATATCTATATGATTGGAGGAATCTTAAGAAATAGTGATACTGA
AAAGGTTTTTAAATATGATTATACAGAAGAAAAATTTACTGAAAGATAAAGTATGATTTA
TGCTAGAAGCTCTTTTGCTGCTGTTTATGTCGACAAATTCATATATGTTATTGGAGGTAA
AAGAGATGGATTAGCATGTTCTGAGTGTGAAAAATATGATCTAGTACAAAATAAATGGAA
AGCTATTGCAAATCTAAACTACTCAGCTTTTTCATCTTCAGTTTGCACTTTTGGAAATAA
TTACTTATATAAATTTGGTGGAATAGGACCAGGCTAAGTGTAAAATAATAACTATGTTGA
ACGTTATGACATTTAGTAGAATTATTGGTAAATAATAAATTTAATGCATGAAGACATTAC
AGGAATTCATAGCATAGGACCTTAAAAAATGTTTGCCCTATTCTTTAACAGTGGAGCTAT
TTAGATAAATGATTCCACTATCTTTGTATTTGGAGGATAGCTAGAAAAGAAAATGTAAAA
ATCAAGCTTTTGTTTTAATATCAAAAAAGAAAAAACCAACAATTAATAAAATATAATGCA
TGTTTTAAACAGATTTGACTACATCCCTCTACCTTCAGCTGGTTCTTTTACATCAAACCC
AATAATTCACAATAACAAGATAATATGTTTATAAAATATTGATAACTCTGTTGGGTAAGG
ATAAAGTTCAATTTACAGTAAAAAGAAATTACTTGTATTTGATGGAACTAATTGGATAGA
AACTATATACAATTTCAATTGA