Identifiers and Description

Gene Model Identifier

TTHERM_00848090

Standard Name

None

Aliases

PreTt29080 | 148.m00094

Description

eukaryotic translation initiation factor 2 alpha subunit; Eukaryotic translation initiation factor 2 alpha subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • eukaryotic translation initiation factor 2 complex (IEA) | GO:0005850

Molecular Function

Biological Process

Domains

  • ( PF00575 ) S1 RNA binding domain
  • ( TIGR00158 ) ribosomal protein L9
  • ( PF07541 ) Eukaryotic translation initiation factor 2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00848090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07278.19.997093137033517e-262eukaryotic translation initiat
ion factor 2 alpha subunit pro
tein (319 aa)
SGDYJR007W1.0004460510701209e-64SUI2 Alpha subunit of the tran
slation initiation factor eIF2
, involved in the identificati
on of the start codon; phospho
rylation of Ser51 is required
for regulation of translation
by inhibiting the exchange of
GDP for GTP
OxytrichaContig7793.0.g59.996907204735647e-62Eukaryotic translation initiat
ion factor 2 alpha subunit
DictyBaseDDB_G02718621.9999167998962255e-60eif2s1 on chromosome: 2 positi
on 944209 to 945663
WormBaseWBGene000213519.9952060159684e-60status:Confirmed UniProt:Q9B
KU3 protein_id:CCD73431.1
Stentor CoeruleusSteCoe_279761.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00848090(coding)
ATGGCTGAAGATAGAAAGAAAATTCAAACCCATCGTTTTTACGAATAAAAGTATCCCAAG
GAAAATGACTTGGTTGTCGTCGAAGTTGTTAAAGTTGAAGAAAACTGCTGTTATGTTTAA
CTTTTAGAATACAACAGAATCGAAGGTATGATTACCCCAAACGAAATGACCAAGCAAATG
TAGTAAAGTATTTAGAAGGTTTTAAAAATTGGTAAATAAGAAGTTGTCCAAGTTCTTAGA
GTTGATGAAGAAAAAGGTTATATTGATTTAAGTAAGAAGAAAGTTAGAAACAATCAAGAT
AATGCCTGTTTAGATAGATTCTCTAAGGCTAAGGATATCCATTCAATTTTGATTACTGTC
TGCGAATCTCTCCCTTAAGATTGCAGTGTTAAAATTGATGATTTATATACTAAGATTGTT
TGGCCTTTATACAAGTTATTCAACCACGCTTATGATGCCTTCAGATTCGCTCTTAACGAT
GAAACCATCATCACCAAGATTGACATTGCTGCTGAAGTTAAAGAAAAGTTGCTCTAAGTT
ATTAGAAGACGTTTGAACACTCAACCTATGAGAATCAAGGCTGACTTTGAATTAAGATGC
CACGAATACGAAGGTATTGATGCTATTAAGGCTGCTTTACTCGCTGGTGAAGCCAAATCA
AGAAATAAATGCGATGTTAAATTTGAAATCATTGGTTCTCCCGTCTATGCTGGTTGCATC
GTCACTCAAGACAAAAATTTAGGTATTGAAGTTCTCAACGAAGCTTTGAAGGCTGTTGAA
GAAGTTATTATCTCTAAAAAGGGTTCTTACAAGCTTAGAACTGAGCCTAAAATTTATGGT
GATAAAGCTCAAGATAACTTAGAAATGTTGGAAAAGGCTGAAGAAGAAGACGAAGATGAT
GAAGATTCTGAAGTCGAAGGTATGGGTGATGACGATGAAGAAGATGAAGAAAACGATAAC
TGA


>TTHERM_00848090(protein)
MAEDRKKIQTHRFYEQKYPKENDLVVVEVVKVEENCCYVQLLEYNRIEGMITPNEMTKQM
QQSIQKVLKIGKQEVVQVLRVDEEKGYIDLSKKKVRNNQDNACLDRFSKAKDIHSILITV
CESLPQDCSVKIDDLYTKIVWPLYKLFNHAYDAFRFALNDETIITKIDIAAEVKEKLLQV
IRRRLNTQPMRIKADFELRCHEYEGIDAIKAALLAGEAKSRNKCDVKFEIIGSPVYAGCI
VTQDKNLGIEVLNEALKAVEEVIISKKGSYKLRTEPKIYGDKAQDNLEMLEKAEEEDEDD
EDSEVEGMGDDDEEDEENDN


>TTHERM_00848090(gene)
ATGGCTGAAGATAGAAAGAAAATTCAAACCCATCGTTTTTACGAATAAAAGTATCCCAAG
GAAAATGACTTGGTTGTCGTAAGCAATATGATTCATATTTAAATCAAATAGATAGATTTA
GCATTTTTTTAAAATTAAGCTAAGCACTTAGATTAATTTTTTCATTATTTTAAGCAATAT
TAAATTTATGAATGAATTAAACTTTATTTAATAGAAAATAAAATAGAATTAAAGTTTAAA
CACATAAATGCAATATAATTTTTATAAATATCAAATAGGTCGAAGTTGTTAAAGTTGAAG
AAAACTGCTGTTATGTTTAACTTTTAGAATACAACAGAATCGAAGGTATGATTACCCCAA
ACGAAATGACCAAGCAAATGTAGTAAAGTATTTAGAAGGTTTTAAAAATTGGTAAATAAG
AAGTTGTCCAAGTTCTTAGAGTTGATGAAGAAAAAGGTAAAACTATAAATTTAAATTGAA
AACAATTCAAATTGCTTGAAAAATACTTTATGGAATAATTTTCAATCCAAAATGGTAGTT
TTTCATTTGCTAATGCAATTACGATTAATAGGATATTAATAAATAAATAAATATTTTATT
TAGATTAATAATGAGAATTTGGAATAAAATGAAAACATATTTTTTGAAAAATAAAAAACA
AAATAGGTTATATTGATTTAAGTAAGAAGAAAGTTAGAAACAATCAAGATAATGCCTGTT
TAGATAGATTCTCTAAGGCTAAGGATATCCATTCAATTTTGATTACTGTCTGCGAATCTC
TCCCTTAAGATTGCAGTGTTAAAATTGATGATTTATATACTAAGATTGTTTGGCCTTTAT
ACAAGTTATTCAACCACGCTTATGATGCCTTCAGATTCGCTCTTAACGATGAAACCATCA
TCACCAAGATTGACATTGCTGCTGAAGTTAAAGAAAAGTTGCTCTAAGTTATTAGAAGAC
GTTTGAACACTCAACCTATGAGAATCAAGGCTGACTTTGAATTAAGATGCCACGAATACG
AAGGTATTGATGCTATTAAGGCTGCTTTACTCGCTGGTGAAGCCAAATCAAGAAATAAAT
GCGATGTTAAAGTAAAAATAAATAAAAATTTCTTATAAATTATATAAAATATCTCTATCT
ATCTATTGATGCTAACTTGATAGATGTATCAAATTTATTATTAACTATAAAGATATCTTT
TAAATAAATAAATCAATCTATCAATCAATCAATAATAGCTGCCAGTTTTTGTTATTTTTG
CAATACATTTTTAACTTTTTGTGTTAATATAATTTTAAATTTTATTCTAGTTTGAAATCA
TTGGTTCTCCCGTCTATGCTGGTTGCATCGTCACTCAAGACAAAAATTTAGGTATTGAAG
TTCTCAACGAAGCTTTGAAGGCTGTTGAAGAAGTTATTATCTCTAAAAAGGGTTCTTACA
AGCTTAGAACTGAGGTATTCATTAGATTTTATATTTAGAATTTTAAAAAGTTAAATAAGT
ATTTTAGAGTTTTAGTCAGATAGAAATAATTAAAATAGGAATTAGATATTTATAAAAAAC
AATGTTTATTAAAATTAGCTTAGAAATTAATGAAATAGAAATTTAATTTATTTAGAAAAA
AATGAAATAGAAAATTAATTTATTTAATTTGTTAATAAAAAATAAATATTAATGTTAATT
AATTCATTATAAAAGCCTAAAATTTATGGTGATAAAGCTCAAGATAACTTAGAAATGTTG
GAAAAGGCTGAAGAAGAAGACGAAGATGATGAAGATTCTGAAGTCGAAGGTATGGGTGAT
GACGATGAAGAAGATGAAGAAAACGATAACTGA