Identifiers and Description

Gene Model Identifier

TTHERM_00842530

Standard Name

None

Aliases

PreTt16238 | 147.m00090 | 3741.m00035

Description

signal recognition particle 68 kDa protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00842530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18928.19.997093137033517e-262hypothetical protein (600 aa)
OxytrichaContig881.1.g521.9994920269952867e-34hypothetical protein
WormBaseWBGene000100971.0003081162615753e-33locus:srpa-68 Probable signa
l recognition particle subunit
SRP68 status:Confirmed Un
iProt:Q20822 protein_id:CAB0
1573.1
DictyBaseDDB_G02858217.000402845995459e-29srp68 on chromosome: 4 positio
n 3701203 to 3703163
Stentor CoeruleusSteCoe_22031.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00842530(coding)
ATGTAAGTAGAATAACCCGTAGCTGTTAATTTAGGCTCATTTGAAATATCTTAAATCATT
AAAACTTCTCAGAGTTAAAATGGTTTAAAGCATTCTGATTTCTAGCGTTACAGAAAGTAT
TGTGGACATAAGGTACACAAGCTTAGAAAATTAATGAAATTCTCTCATGAGAAAAAGTAC
CAAAAGAAGCAAATCCATGTTGAAAGATTAAATGACCCTAAAATGCTCTAAGTTCTTCTT
TTCAAGATTGAAAATAATTGGGCTTATGCTATGGATTTAAAGCAGATTATGCAAGATAGT
AAAGATGGAGCAGCCAGAAAGTAGCATCATGTTAATAAAAAAATGGCTAAAGCTTTGAAA
TGGGCTAATTTACTTAATAATATCTGCAGAGAGCGTACAGATGAAAGAAGTTATCAAGAA
AGCGAAGCATATTTGAATTTTATCAAAGGTATTTATCACCATGAGAGACACTAATGGGAA
GATGCATTAGAAAGTTATATTAAATCTCGTTCTATCTATCTTAGCCTTATATCAGTTTCT
GACTCTCTTTAATCAGTTTTCTTTAAGGAAAAGGTTGAATTCTTAGAACAATCTATCAGA
TATTGCCATCAACAAAATAATGGTTTCATTTTGGATACTATCGATGTTATTATTTCTAAA
ATGGGTACTAAAATGGATATTGAAAAAACACCTACTTCTAAGGTTGCTTAGTCTGAGAAA
AAAGACTAGTTGATCGAAGTTGATTACTTAGGTTCTAAGTATCCAATTAAAAACTAGAAA
GCCATCTATTCTTACAGATAAGTTGAAGATTGCTAAAAGAGAATTCACGAATTGCAAAGA
AAGACATCCAAAACTAACACTTAAGAAGAGCAAGATAGTATTTTGGCAATTTACAACGAA
GCTTTCAATAACTTTGATGAATGCATTAAGGTTATTTAAAAGGAAAAGTCAGATGAAAAG
AACTCAGAAGCAGAAAATTTAATCTACACAAACATTCTTAGCTTTTTGAACTTAAATAAA
TAAAAATTCATTTTAGATAGAAATATTATTCTTATCAAAAATGCTGTTTAGTAGTTCGAT
AAAGAAGATGGTGTCAATAATTTGGAAGCTTTGACTACAAAGAAGGCATTCAAGCTTAAG
CTTATTAGACCAACTGAAATTATTAAACTCTGTGATAACCTTTTGCAAGTTTTCAAATAA
ATAATCGAAGTAGAAAGATAAAATACAAATTTAGAAAACTATAGAAAACTTGATGTTTTA
GAATTCCACTTCAAGGCAATCAGATGCTACTACGTCTCTTGCGTTTATTTAGCCAACTCA
AAATATATTGAAACTTTATCTTTACTCAAGGTTGCTGAAAATATTGTAACCAACTCTTCT
AAAAAGTTTGTTGATATGAGAGATAATTTTGTAGAAGATTATGTTGAAGAAAGCGACATC
TTAATGAAAAAGATCAAGTATTTAGAAATCAAGGCTAAACTTGGCTTAGTTGAAAATACA
ACTGAAGAAGAAACTGTAATTACTGAAAAGCTTGCAGACAGCAATTTGGATGGAAAAGTC
ACTAATAAAACCATCTAAAGTTTAATGAAAGAATAAGAATAAGGAAATAAATTAAATGTT
GGTATCAATAGATTAAATAGCATTCCCATATTTGCTCTTCCTCCTAAGCCTTTGCTTGCT
GGCTGCAAACCTATTTAATTTGATTTGGTAGACGAATATATTAATTACCCTAAGATAGAT
GTTTAACAACCAAAGCAACAAGCTGGTTTCTTAAATAAATTCAAGTTTTGGTGA


>TTHERM_00842530(protein)
MQVEQPVAVNLGSFEISQIIKTSQSQNGLKHSDFQRYRKYCGHKVHKLRKLMKFSHEKKY
QKKQIHVERLNDPKMLQVLLFKIENNWAYAMDLKQIMQDSKDGAARKQHHVNKKMAKALK
WANLLNNICRERTDERSYQESEAYLNFIKGIYHHERHQWEDALESYIKSRSIYLSLISVS
DSLQSVFFKEKVEFLEQSIRYCHQQNNGFILDTIDVIISKMGTKMDIEKTPTSKVAQSEK
KDQLIEVDYLGSKYPIKNQKAIYSYRQVEDCQKRIHELQRKTSKTNTQEEQDSILAIYNE
AFNNFDECIKVIQKEKSDEKNSEAENLIYTNILSFLNLNKQKFILDRNIILIKNAVQQFD
KEDGVNNLEALTTKKAFKLKLIRPTEIIKLCDNLLQVFKQIIEVERQNTNLENYRKLDVL
EFHFKAIRCYYVSCVYLANSKYIETLSLLKVAENIVTNSSKKFVDMRDNFVEDYVEESDI
LMKKIKYLEIKAKLGLVENTTEEETVITEKLADSNLDGKVTNKTIQSLMKEQEQGNKLNV
GINRLNSIPIFALPPKPLLAGCKPIQFDLVDEYINYPKIDVQQPKQQAGFLNKFKFW


>TTHERM_00842530(gene)
ATGTAAGTAGAATAACCCGTAGCTGTTAATTTAGGCTCATTTGAAAGTAACTTAGCATAT
TTATTATTCTTGATAATATATCACATTCATAACATTAAGCGAAAATAGATAGTTCCTTCC
TTATTTGTTTTTATTTGGAAATCTAATTCATATTATTTACAATCAAAATGAAATAAATAA
GCTTATTTATTATATCATTTAACTTCTTTTAATATTTAATAACAGTATCTTAAATCATTA
AAACTTCTCAGAGTTAAAATGGTTTAAAGCATTCTGATTTCTAGCGTTACAGAAAGTATT
GTGGACATAAGGTACACAAGCTTAGAAAATTAATGAAATTCTCTCATGAGAAAAAGTACC
AAAAGAAGCAAATCCATGTTGAAAGATTAAATGACCCTAAAATGCTCTAAGTTCTTCTTT
TCAAGATTGAAAATAATTGGGCTTATGCTATGGATTTAAAGCAGATTATGCAAGATAGTA
AAGATGTACAAAGAATTAATTTTATTACATTTACAAAACAAGGAATCAATTATTAGAAAG
AGAAGAATATAAGATTTCTAATTAATTAATTAAAACAAACATTAAAGTAGAATACTAATT
TTATTTGTTAAAAATTTAAGGGAGCAGCCAGAAAGTAGCATCATGTTAATAAAAAAATGG
CTAAAGCTTTGAAATGGGCTAATTTACTTAATAATATCTGCAGAGAGCGTACAGATGAAA
GAAGTTATCAAGAAAGCGAAGCATATTTGAATTTTATCAAAGGTATTTATCACCATGAGA
GACACTAATGGGAAGATGCATTAGAAAGTTATATTAAATCTCGTTCTATCTATCTTAGCC
TTATATCAGTTTCTGACTCTCTTTAATCAGTTTTCTTTAAGGAAAAGGTTGAATTCTTAG
AACAATCTATCAGGTAGCTTATAAAAACTTTAAATATTCACTTATTGTTTATTGATATTT
ATGCTTAAAAAATAACAGATATTGCCATCAACAAAATAATGGTTTCATTTTGGATACTAT
CGATGTTATTATTTCTAAAATGGGTACTAAAATGGATATTGAAAAAACACCTACTTCTAA
GGTTGCTTAGTCTGAGAAAAAAGACTAGTTGATCGAAGTTGATTACTTAGGTTCTAAGTA
TCCAATTAAAAACTAGAAAGCCATCTATTCTTACAGATAAGTTGAAGATTGCTAAAAGAG
AATTCACGAATTGCAAAGAAAGACATCCAAAACTAACACTTAAGAAGAGCAAGATAGTAT
TTTGGGTAAAAATTACATTATTTCTATATAAAAATGGTTTATAACTTTTTAATTAATTTT
ATATCAAGCAATTTACAACGAAGCTTTCAATAACTTTGATGAATGCATTAAGGTTATTTA
AAAGGAAAAGTCAGATGAAAAGAACTCAGAAGCAGAAAATTTAATCTACACAAACATTCT
TAGCTTTTTGAACTTAAATAAATAAAAATTCATTTTAGATAGAAATATTATTCTTATCAA
AAATGCTGTTTAGTAGTTCGATAAAGAAGATGGTGTCAATAATTTGGAAGCTTTGACTAC
AAAGAAGGCATTCAAGCTTAAGCTTATTAGACCAACTGAAATTATTAAACTCTGTGATAA
CCTTTTGCAAGTAATTTTATAATTTAAAATGAATGTTCTTGTTTTTTTTAAAAGTACTTT
TTAAAAAAATAAATAAAGGTTTTCAAATAAATAATCGAAGTAGAAAGATAAAATACAAAT
TTAGAAAACTATAGAAAACTTGATGTTTTAGAATTCCACTTCAAGGCAATCAGATGCTAC
TACGTCTCTTGCGTTTATTTAGCCAACTCAAAATATATTGAAACTTTATCTTTACTCAAG
GTTGCTGAAAATATTGTAACCAACTCTTCTAAAAAGTTTGTTGATATGAGAGATAATGTA
TTTTTCTTATAATTTATTTATGTATTTATTTTTAAGTCTGTGAATAAAAACAATAGTTTG
TAGAAGATTATGTTGAAGAAAGCGACATCTTAATGAAAAAGATCAAGTATTTAGAAATCA
AGGCTAAACTTGGCTTAGTTGAAAATACAACTGAAGAAGAAACTGTAATTACTGAAAAGC
TTGCAGACAGCAATTTGGATGGAAAAGTCACTAATGTAAAATAAAAATAAATAAATAAAT
AAATAAATAAATAAATTAACTTTAACACTTACATTTACTATTATACTCTTATAAATAGAA
AACCATCTAAAGTTTAATGAAAGAATAAGAATAAGGAAATAAATTAAATGTTGGTATCAA
TAGATTAAATAGCATTCCCATATTTGCTCTTCCTCCTAAGCCTTTGCTTGCTGGCTGCAA
ACCTATTTAATTTGATTTGGTAAGATTTTAGCATAATTAAGTGTTCATAAAATGACTAAC
CATCTATTAAAAATAAATATAGGTAGACGAATATATTAATTACCCTAAGATAGATGTTTA
ACAACCAAAGCAACAAGCTGGTTTCTTAAATAAATTCAAGTTTTGGTGA