Identifiers and Description

Gene Model Identifier

TTHERM_00842500

Standard Name

None

Aliases

PreTt16235 | 147.m00087 | 3741.m00032

Description

U1 small nuclear ribonucleoprotein A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00842500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18931.13.9988573992424687e-147U1 small nuclear ribonucleopro
tein A (247 aa)
OxytrichaContig12619.0.g676.002397656030775e-43RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02883914.001118334825066e-42snrpB2 on chromosome: 5 positi
on 1486880 to 1487969
WormBaseWBGene000043853.998097515166115e-39locus:rnp-2 status:Confirmed
UniProt:Q21322 protein_id
:CCD72715.1
Stentor CoeruleusSteCoe_54833.1391327920480296e-17
SGDYIR009W0.0000000000019997478866288316MSL1 U2B component of U2 snRNP
, involved in splicing, binds
the U2 snRNA stem-loop IV in v
itro but requires association
of Lea1p for in vivo binding;
does not contain the conserved
C-terminal RNA binding domain
found in other family members

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00842500(coding)
ATGGATAATAAGCAAAGCATTCCTGTTCCAGATAATAAAGAAAACGAAATGTAGGAAGAA
GTAGAAGAGGAAATTAAGTTATTACCTCCTAACAATACAATCTACATTAATAACTTAAAT
GAAAGAATCAGTATTGACGATTTAAAATAAGAGTTATTTAAGCTTTTTTCCGAATATGGT
AGCATACTTGAAATAAAGGCCAAGAAAAATATTCGTATGAGAGGATAAGCTTTTGTAGTT
TTTGAATAGATAGCATGTGCACAAAAAGCCATAGAGGCTTTAAACAGAAAAAACTTTTAT
GGCAAGGCATTACATTTAAATTTTGCAAAAACAAAAAGTGATGCAATTCTTAAAAGAGAA
GGAGCCTACGCCCCTCGCTAGCCTAAAATATTTAATGCTGCAGATTTTATTGAAGAAAGA
TAATCAAATAAAAAATAAAAAGAAAATTTAAAAAACAAGGAATCTGCAACAGCTAAACTT
GCTGCCTAGCCATTAGTTCAAAATACAATCATATAGCCTCACCATACTCTTTTCTTAGAA
AATTTACCTATAAACTCCAATACAGAAGTCATTAAAGCATTCTTTGCAACATTCCCAGGA
TTCAAGGAAGTGCGTCTAGTACCTTAAAAAAGAGTTGCTTTCGTAGAATATGAAGATGAA
AATAAAGCAACTGCAGCATTGGCATCTTTACAATCATTTAAGATTGGAGATCAAACTGTT
ACAGCTAACTATGCAAAAGCTTGA


>TTHERM_00842500(protein)
MDNKQSIPVPDNKENEMQEEVEEEIKLLPPNNTIYINNLNERISIDDLKQELFKLFSEYG
SILEIKAKKNIRMRGQAFVVFEQIACAQKAIEALNRKNFYGKALHLNFAKTKSDAILKRE
GAYAPRQPKIFNAADFIEERQSNKKQKENLKNKESATAKLAAQPLVQNTIIQPHHTLFLE
NLPINSNTEVIKAFFATFPGFKEVRLVPQKRVAFVEYEDENKATAALASLQSFKIGDQTV
TANYAKA


>TTHERM_00842500(gene)
ATGGATAATAAGCAAAGCATTCCTGTTCCAGATAATAAAGAAAACGAAATGTAGGAAGAA
GTAGAAGAGGAAATTAAGTTATTACCTCCTAACAATACAATCTACATTAATAACTTAAAT
GAAAGAATCAGTATTGACGATTTAAAATAAGAGTTATTTAAGCTTTTTTCCGAATATGGT
AGCATACTTGAAATAAAGGCCAAGAAAAATATTCGTATGAGAGGATAAGCTTTTGTAGTT
TTTGAATAGATAGCATGTGCACAAAAAGCCATAGAGGCTTTAAACAGAAAAAACTTTTAT
GGCAAGGCATTAGTAATGATATAATTAATTTAATGTCTTCTCTTTAATTGAAAAATATGA
TAACATAAAATTTCAAAAATTGTTAGATAATAATCAAGATTTTTATGAGAGATTATTAAA
ACATGAATGCATAGATTTATCATTTATTAAATAACCATATTTTTAAATAAATAGCATTTA
AATTTTGCAAAAACAAAAAGTGATGCAATTCTTAAAAGAGAAGGAGCCTACGCCCCTCGC
TAGCCTAAAATATTTAATGCTGCAGATTTTATTGAAGAAAGATAATCAAATAAAAAATAA
AAAGAAAATTTAAAAAACAAGGAATCTGCAACAGCTAAACTTGCTGCCTAGCCATTAGTT
GTAATAGAAATTAATTTTATAATACTTTTAGTCTTTTTTCAAATAAGTTATTCACTATTT
TTTAATATTAATTAGCAAAATACAATCATATAGCCTCACCATACTCTTTTCTTAGAAAAT
TTACCTATAAACTCCAATACAGAAGTCATTAAAGCATTCTTTGCAACATTCCCAGGATTC
AAGTAAAATTTAATATATGATGAATTAAAAGATTGTCTTAACTTTAACCTAAATCTCTCA
ACATTTTAAGAAATATTTAACAAATTAAATTAATAATATAGGGAAGTGCGTCTAGTACCT
TAAAAAAGAGTTGCTTTCGTAGAATATGAAGATGAAAATAAAGCAACTGCAGCATTGGCA
TGTAAAAATACTTCAATTCAAATTATTTTATTTTCATAAAAATTAATAAAATTATCTAGC
TTTACAATCATTTAAGATTGGAGATCAAACTGTTACAGCTAACTATGCAAAAGCTTGA