Identifiers and Description

Gene Model Identifier

TTHERM_00842380

Standard Name

MybL1 (Myb-like-1)

Aliases

PreTt16223 | 147.m00075 | 3741.m00020

Description

Myb-like DNA-binding domain protein.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF08729 ) Histone promoter control 2 (HPC2)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00842380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18944.29.997093137033517e-262myb-like DNA-binding domain-co
ntaining protein (956 aa)
OxytrichaContig6866.0.1.g156.996899116468003e-76Myb-like DNA-binding domain
DictyBaseDDB_G02893193.000619078166531e-39mybQ on chromosome: 5 position
2641022 to 2643751
Stentor CoeruleusSteCoe_197783.6251409191435593e-34
SGDYKR099W2.999758165421992e-18BAS1 Myb-related transcription
factor involved in regulating
basal and induced expression
of genes of the purine and his
tidine biosynthesis pathways;
also involved in regulation of
meiotic recombination at spec
ific genes
WormBaseWBGene000015680.00000000000003999587784428659locus:snpc-4 status:Partiall
y_confirmed UniProt:O62208
protein_id:CAB04248.1

General Information

Paragraph NoGene NameParagraph Text
147MybL1MybL1 was detected as a high-confidence interaction partner of RebL1 and Anqa1 during growth and conjugation. MybL1 interaction with these proteins is possibly in the context of putative MuvB complex to form an activator MMB-complex (Nabeel-Shah et al. 2021).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00842380(coding)
ATGCATATGATCAAGAGTGAAACCTAGCCTGAAGGTAACTCAATTGAAACCAAAATCGAA
GAAGGCTAACAAAATAGCATTCAAATAGTTCAAGAGTAGTAAGCTTAGCAACTTGTTGCT
TCTGCCCTCGACATTTCTAATAGATAAGGTGGTATGAGACCTCAAGACCAGAATTTTTCA
GTAGAAAAGAGTGAAGGGAAATAAGTAGTAAATAAAAAGGAAGAAGCAATTAATGAAAAA
TAAAATAAAGAATAAGATGCCTAACAATAAATTAGCAGTATCATGCATAATTAATCCTAA
TAGTAGTAGCAAGCAGAAGAGGATGAATTCATGAAACTCAAACAGCTATTAGAAGTTATT
AAGAGTAAGTATAATGTGCAATCAGATGATGTAATTAAATATGCTTTAAACAACACATCT
CAATTAATTTAGATGCCAGAAGGATTAAAGGCTGCTTCTTCAGATAACAACAGCAACCAG
CCTGGCAAAGATTTGGCTTCAACAGTAATCAATCATCTCTTCTCTAACTCTTCTATAAAT
TAAAATCAAATTAAAAATTCTTAAATAAATGCTCCTATCATCTCTTCCACATCAAATTCT
TAGTTATTACTTCCAACACCTCTTAATTCCTTAAACATCTCCGCCAATATTCATGCTGCA
TTTTAGTCTAAAATTGAAGAGAATGAATCTTCTGCTTGTGCTTATTCTGTTGAACCTCCT
CTTAGAAAGAAATAAAATTCTAAGAGCTCTTAGAAAAATGTTAAAAAGGCAAGCATGATA
TCTAATGAAAATGATGGTAGTGAAAATGATATGGACGAAGAAAATTCTAATGAAACAAAC
CAAGATAACATGCACTCTTAACACTAAACATTATCAGGCGAATAAAGCTTCAAAAAGACT
AAGAAATCCAAAGAATAAAAAATTTAAAGGAAGTAGTCGTTGAAGGTCAAAAAGCTAAAT
TCAATCAAACAAGAAAGCTAAATAGAAGAAGAGAATCAATAAGAAAGTCTAGTAAATAAT
GAAGAAAAATAAACCATGAATGAAGAAAATAATGAAGACTATATTGATGATGACGAAGAT
GATGACATGCTTGATGAAGAAGACGATGATATGATGGATGAATATGAATCTAATGAATCT
AGAAAACTTGAAAGCAACACTAATAACCCAAATGGTGAAAAGATTGTTCGTCCTAAATAC
AAAAATTCAAATTCCCCTTCAAATACAACCAAAAGGTGGTGGACAAAAGAAGAGGATGAA
CTCTTAAAAAACCTTGTAAAAGATCATGGTGCTAAAAATTGGAAAAAAATTGCTGGCTAT
TTTAAGGAACGCAGCGATGTTTAATGTTTACACAGATGGTAAAAAGTTTTAAATCCATCT
CTTGTTAAAGGGCCTTGGACCAAGGAAGAAGATGAAATAGTAACAAAATTAGTTCTTGAA
TAAGGCCCCAAAAATTGGAGTTCTATTGCCAAGCATTTACCTGGTCGTATTGGAAAACAA
TGCAGAGAAAGATGGCACAATCACTTAAATCCATACATCAAGAAAGACAGATGGACTGAG
GAAGAAGATCAAGCTATTATTGAAGCTCATAAAAGATTAGGAAATAGATGGGCTCTTATT
GCTAAGTATTTACCAGGCCGTACTGATAACGCAATCAAAAATCACTGGAATTCAACTATC
AAGAGAAAATTAAAAATGTAAAAGCGTGAAGAAGATTTAGAACCTCCCAAAAAGAAAAAT
TTAAATATTAAGGAAATAGAAGAAGAATTGTCAAATATGCCCTCAGTTAACTTATTAAAA
AATGAAGCTTATATGAAATAGTTCCATCTTTAAAATGCATAATATAATGAGGGAATTAAA
TAGCTCAATTCAGAATCAAATATTAATCACTCTAAAATGGAAGATAGAGATGATGATGAC
GACGAAGAAGATAGCGATGAAGAAAATTTATCAAATGAATAGCTCTCTTAACCTAATTTG
AATAACTCTAGAGCAAATAGCATCCAACTTCCTATGGTTTCTGTCAAGGAAGAAGAATAA
GAAACAACTTATAAGAAAAGTGCTATTCAATCATCTAAAGAAAAAGATACTATAAAGAAA
GAAGTAAAATAACGTAAAAAAGAAAAGGGAGAATTTATCACACCTGATAAAAAATCTAAT
TTCATTAGCTAAGAAACAACTGCTCCTACTACTTAAGCTGACAATCATTTACGCTCAATA
GAACAAAGAAATTAGTCATTTTTAAATAACGAAAATGATTTCGTCACACCTGTTAAACAC
TTAAACTTTTCAACTCCTAAAAACACTTAAGCAAATAAAGAAAAGTCAAATTTAAAATCT
GTATCTAATTAAAAAGAATCCTTCATACTGCATCCAAGCAAAAAAAGTCTCAATATAGTA
TTCCCTAATTTTACACTTAGTGACATATTAAAAATCGAAAACTCAGTCACTTTGATGAAG
ACACTACTCAGATAAGCAGAATTACCAGATCTTTCTACTTCTTATTAGTTTTTCGATTAA
TAATACAGCCAAGCATAGTCACCTTTAAGTTTTAGAGGAGCTAAAAATGACGAAAATAAC
AGCATGTATTTTGAAAAATCAGTTAACTAACTTTAAAGTTCAAGTAAAACAACATCACTC
TTACAAAACAATAATAATGCCATAAATATCCCCACTCCTACTTTATCTAAACCTAGCTCA
GGATTTAAACCTGTAGGATCTTCTATTACAAGTTTAAAAAGACCTCACCCAGATAAATTT
GATGGAATAAAAAAAGAGCTTTCCTTCACATCTCCATAAGAAAAATCAATAGTAATGAAA
AGTATAAATTCTTTTGGGACACCTGAAATGAGAGAAGAGCTATCAACAGCTTGA


>TTHERM_00842380(protein)
MHMIKSETQPEGNSIETKIEEGQQNSIQIVQEQQAQQLVASALDISNRQGGMRPQDQNFS
VEKSEGKQVVNKKEEAINEKQNKEQDAQQQISSIMHNQSQQQQQAEEDEFMKLKQLLEVI
KSKYNVQSDDVIKYALNNTSQLIQMPEGLKAASSDNNSNQPGKDLASTVINHLFSNSSIN
QNQIKNSQINAPIISSTSNSQLLLPTPLNSLNISANIHAAFQSKIEENESSACAYSVEPP
LRKKQNSKSSQKNVKKASMISNENDGSENDMDEENSNETNQDNMHSQHQTLSGEQSFKKT
KKSKEQKIQRKQSLKVKKLNSIKQESQIEEENQQESLVNNEEKQTMNEENNEDYIDDDED
DDMLDEEDDDMMDEYESNESRKLESNTNNPNGEKIVRPKYKNSNSPSNTTKRWWTKEEDE
LLKNLVKDHGAKNWKKIAGYFKERSDVQCLHRWQKVLNPSLVKGPWTKEEDEIVTKLVLE
QGPKNWSSIAKHLPGRIGKQCRERWHNHLNPYIKKDRWTEEEDQAIIEAHKRLGNRWALI
AKYLPGRTDNAIKNHWNSTIKRKLKMQKREEDLEPPKKKNLNIKEIEEELSNMPSVNLLK
NEAYMKQFHLQNAQYNEGIKQLNSESNINHSKMEDRDDDDDEEDSDEENLSNEQLSQPNL
NNSRANSIQLPMVSVKEEEQETTYKKSAIQSSKEKDTIKKEVKQRKKEKGEFITPDKKSN
FISQETTAPTTQADNHLRSIEQRNQSFLNNENDFVTPVKHLNFSTPKNTQANKEKSNLKS
VSNQKESFILHPSKKSLNIVFPNFTLSDILKIENSVTLMKTLLRQAELPDLSTSYQFFDQ
QYSQAQSPLSFRGAKNDENNSMYFEKSVNQLQSSSKTTSLLQNNNNAINIPTPTLSKPSS
GFKPVGSSITSLKRPHPDKFDGIKKELSFTSPQEKSIVMKSINSFGTPEMREELSTA


>TTHERM_00842380(gene)
ATGCATATGATCAAGAGTGAAACCTAGCCTGAAGGTAACTCAATTGAAACCAAAATCGAA
GAAGGCTAACAAAATAGCATTCAAATAGTTCAAGAGTAGTAAGCTTAGCAACTTGTTGCT
TCTGCCCTCGACATTTCTAATAGATAAGGTGGTATGAGACCTCAAGACCAGAATTTTTCA
GTAGAAAAGAGTAAATAAATTCACCATCAGTTTAATAACAACTATAATGATTTAATTAAT
CAAAAGGTGAAGGGAAATAAGTAGTAAATAAAAAGGAAGAAGCAATTAATGAAAAATAAA
ATAAAGAATAAGATGCCTAACAATAAATTAGCAGTATCATGCATAATTAATCCTAATAGT
AGTAGCAAGCAGAAGAGGATGAATTCATGAAACTCAAACAGCTATTAGAAGTTATTAAGA
GTAAGTATAATGTGCAATCAGATGATGTAATTAAATATGCTTTAAACAACACATCTCAAT
TAATTTAGATGCCAGAAGGATTAAAGGCTGCTTCTTCAGATAACAACAGCAACCAGCCTG
GCAAAGATTTGGCTTCAACAGTAATCAATCATCTCTTCTCTAACTCTTCTATAAATTAAA
ATCAAATTAAAAATTCTTAAATAAATGCTCCTATCATCTCTTCCACATCAAATTCTTAGT
TATTACTTCCAACACCTCTTAATTCCTTAAACATCTCCGCCAATATTCATGTAAATTATT
AACATAAGATCTTTTAAAACACTCTTCAAATTAATAAACGGTCTTTAATCGAGTTAGTTT
TATTATTTATTCAGCTCAGATCCTAATATTGCTTCTATTTAACGCATATTATTTTTTATT
TCTTTTCTTCTTTTCTCATTTCTTTGGACAGCAAGATAGATAGATTAATAGATACATTTC
TCTTGATTTAATTTTCTATTAATTTTTTGCTTCCTTTTTGCTTTAAAATTATCAAACTTC
TTTCCATATTTGATTACTCAACAAAAGTCTTGAAAGACTTTAGCAGAAAATTTTTTCAGT
TCTACATCCAATTTTTTACTTTATTATAAATTTTGCATCAATTAATAATTGCTTCCTATT
CGATGAACTCTTAGACATTTTTAATAAATTTTATTGCACCTTTGCACATAAGTAAATACA
GTCTTGACTGAATAAAACTAACAAACCGTTTCATCTTAAAATTTTATTTTAGGCTTAATC
TAATTTAATTTCTTAATTCATTTATTACTAGGCTGCATTTTAGTCTAAAATTGAAGAGAA
TGAATCTTCTGCTTGTGCTTATTCTGTTGAACCTCCTCTTAGAAAGAAATAAAATTCTAA
GAGCTCTTAGAAAAATGTTAAAAAGGCAAGCATGATATCTAATGAAAATGATGGTAGTGA
AAATGATATGGACGAAGAAAATTCTAATGAAACAAACCAAGATAACATGCACTCTTAACA
CTAAACATTATCAGGCGAATAAAGCTTCAAAAAGACTAAGAAATCCAAAGAATAAAAAAT
TTAAAGGAAGTAGTCGTTGAAGGTCAAAAAGCTAAATTCAATCAAACAAGAAAGCTAAAT
AGAAGAAGAGAATCAATAAGAAAGTCTAGTAAATAATGAAGAAAAATAAACCATGAATGA
AGAAAATAATGAAGACTATATTGATGATGACGAAGATGATGACATGCTTGATGAAGAAGA
CGATGATATGATGGATGAATATGAATCTAATGAATCTAGAAAACTTGAAAGCAACACTAA
TAACCCAAATGGTGAAAAGATTGTTCGTCCTAAATACAAAAATTCAAATTCCCCTTCAAA
TACAACCAAAAGGTGGTGGACAAAAGAAGAGGATGAACTCTTAAAAAACCTTGTAAAAGA
TCATGGTGCTAAAAATTGGAAAAAAATTGCTGGCTATTTTAAGGAACGCAGCGATGTTTA
ATGTTTACACAGATGGTAAAAAGTTTTAAATCCATCTCTTGTTAAAGGGCCTTGGACCAA
GGAAGAAGATGAAATAGTAACAAAATTAGTTCTTGAATAAGGCCCCAAAAATTGGAGTTC
TATTGCCAAGCATTTACCTGGTCGTATTGGAAAACAATGCAGAGAAAGGTATTTATTTAT
TTATCTTTGACATTTTGCAACAAAAACATAAAAAACAATTTACTCTCTTTTTGGATTTTA
TAAATGCGCGCTATTTTAATTAAACTTTTGCAAAAATTAAATAATAAAATTTAATAATTA
GATGGCACAATCACTTAAATCCATACATCAAGAAAGACAGATGGACTGAGGAAGAAGATC
AAGCTATTATTGAAGCTCATAAAAGGTAAAGAAATTAAGCCTACTTTAATATATAATTAA
AATAGAATTATTATTTGCTTCACAAAAAGTAGATTTCATTCAATAGATATTTTATTGAAT
AGTGTCTTATTTATTAGTATCTTTAAAACTGAGTGAGTGTGCATGCTTATCCAAAATTTC
TCACAAAAAAAAACAAAACACAGAAAACAAGATTTTAATTCGAAAAGGAACGTTAATAAT
TTTCTTAAGAAATTTAGCATACATAATTTTGTGGGAAAATTAACTATATTCGTAAAATTT
AACTTGGCACACAAAAATAAAATTAATTGACAAAACTAAACATATCTTTTATTTTTCCTC
TTTATTTTCAATGATTCTTTCAATTCTATTTAAACATAACACTAACTCTAACTCTTTTAT
TTTTATGAGAGATAAATTTTAATTAACTTTTCTGACATTCATTCAAATGTATCCATTAAA
AATTCATTGTTTGAATTCTTGAGTTAAGCAAGCACATAATACAAACAAACACAAATAAAT
AAAAACACTCGAAAAATTAAAATATATTTTTCTAATAAAATTTGATTCTTTTGCTAATAA
ATTCTAAATAGTCTTTAATTTTCTAGTTCGATTAACAAAAAAAAATTAATTCAACTTTTA
ATATTTATACAAAATAAATCCATTAATTGATTAATTCAATTCTATTTTAAATCTAATTTA
AATATTAACGCTTTGCTTTTAATACATAATTTTATATAAAAAAATAGATTAGGAAATAGA
TGGGCTCTTATTGCTAAGTATTTACCAGGCCGTACTGATAACGCAATCAAAAATCACTGG
AATTCAACTATCAAGAGAAAATTAAAAATGTAAAAGCGTGAAGAAGATTTAGAACCTCCC
AAAAAGAAAAATTTAAATATTAAGGAAATAGAAGAAGAATTGTCAAATATGCCCTCAGTT
AACTTATTAAAAAATGAAGCTTATATGAAATAGTTCCATCTTTAAAATGCATAATATAAT
GAGGGAATTAAATAGCTCAATTCAGAATCAAATATTAATCACTCTAAAATGGAAGATAGA
GATGATGATGACGACGAAGAAGATAGCGATGAAGAAAATTTATCAAATGAATAGCTCTCT
TAACCTAATTTGAATAACTCTAGAGCAAATAGCATCCAACTTCCTATGGTTTCTGTCAAG
GAAGAAGAATAAGAAACAACTTATAAGAAAAGTGCTATTCAATCATCTAAAGAAAAAGAT
ACTATAAAGAAAGAAGTAAAATAACGTAAAAAAGAAAAGGGAGAATTTATCACACCTGAT
AAAAAATCTAATTTCATTAGCTAAGAAACAACTGCTCCTACTACTTAAGCTGACAATCGT
AATATTAAAAAAATAAAAATATAGCTAAATATTAATTAAATCATATTTAAAATTATATTA
GATTTACGCTCAATAGAACAAAGAAATTAGTCATTTTTAAATAACGAAAATGATTTCGTC
ACACCTGTTAAACACTTAAACTTTTCAACTCCTAAAAACACTTAAGCAAATAAAGAAAAG
TCAAATTTAAAATCTGTATCTAATTAAAAAGGTATATTTAAAGTTATTTCCTTAAATTAT
TTTAATACTTATTTTCTAACTCAATAAGAATCCTTCATACTGCATCCAAGCAAAAAAAGT
CTCAATATAGTATTCCCTAATTTTACACTTAGTGACATATTAAAAATCGAAAACTCAGTC
ACTTTGATGAAGACACTACTCAGATAAGCAGAATTACCAGATCTTTCTACTTCTTATTAG
TTTTTCGATTAATAATACAGCCAAGCATAGTCACCTTTAAGTTTTAGAGGAGCTAAAAAT
GACGAAAATAACAGCATGTATTTTGAAAAATCAGTTAACTAACTTTAAAGTTCAAGTAAA
ACAACATCACTCTTACAAAACAATAATAATGCCATAAATATCCCCACTCCTACTTTATCT
AAACCTAGCTCAGGATTTAAACCTGTAGGATCTTCTATTACAAGTTTAAAAAGACCTCAC
CCAGATAAATTTGATGGAATGTATGCCAATTAATTTTAATTATTAGAAGAAAAAGTTAAT
TTAATTTTATTTTTTAAAAAAGAAAAAAAGAGCTTTCCTTCACATCTCCATAAGAAAAAT
CAATAGTAATGAAAAGTATAAATTCTTTTGGGACACCTGAAATGAGAGAAGAGCTATCAA
CAGCTTGA