Identifiers and Description

Gene Model Identifier

TTHERM_00842380

Standard Name

None

Aliases

PreTt16223 | 147.m00075 | 3741.m00020

Description

Myb-like DNA-binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF08729 ) Histone promoter control 2 (HPC2)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00842380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18944.29.997093137033517e-262myb-like DNA-binding domain-co
ntaining protein (956 aa)
OxytrichaContig6866.0.1.g156.996899116468003e-76Myb-like DNA-binding domain
DictyBaseDDB_G02893193.000619078166531e-39mybQ on chromosome: 5 position
2641022 to 2643751
Stentor CoeruleusSteCoe_197783.6251409191435593e-34
SGDYKR099W2.999758165421992e-18BAS1 Myb-related transcription
factor involved in regulating
basal and induced expression
of genes of the purine and his
tidine biosynthesis pathways;
also involved in regulation of
meiotic recombination at spec
ific genes
WormBaseWBGene000015680.00000000000003999587784428659locus:snpc-4 status:Partiall
y_confirmed UniProt:O62208
protein_id:CAB04248.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00842380(coding)
ATGCATATGATCAAGAGTGAAACCTAGCCTGAAGGTAACTCAATTGAAACCAAAATCGAA
GAAGGCTAACAAAATAGCATTCAAATAGTTCAAGAGTAGTAAGCTTAGCAACTTGTTGCT
TCTGCCCTCGACATTTCTAATAGATAAGGTGGTATGAGACCTCAAGACCAGAATTTTTCA
GTAGAAAAGAGTGAAGGGAAATAAGTAGTAAATAAAAAGGAAGAAGCAATTAATGAAAAA
TAAAATAAAGAATAAGATGCCTAACAATAAATTAGCAGTATCATGCATAATTAATCCTAA
TAGTAGTAGCAAGCAGAAGAGGATGAATTCATGAAACTCAAACAGCTATTAGAAGTTATT
AAGAGTAAGTATAATGTGCAATCAGATGATGTAATTAAATATGCTTTAAACAACACATCT
CAATTAATTTAGATGCCAGAAGGATTAAAGGCTGCTTCTTCAGATAACAACAGCAACCAG
CCTGGCAAAGATTTGGCTTCAACAGTAATCAATCATCTCTTCTCTAACTCTTCTATAAAT
TAAAATCAAATTAAAAATTCTTAAATAAATGCTCCTATCATCTCTTCCACATCAAATTCT
TAGTTATTACTTCCAACACCTCTTAATTCCTTAAACATCTCCGCCAATATTCATGCTGCA
TTTTAGTCTAAAATTGAAGAGAATGAATCTTCTGCTTGTGCTTATTCTGTTGAACCTCCT
CTTAGAAAGAAATAAAATTCTAAGAGCTCTTAGAAAAATGTTAAAAAGGCAAGCATGATA
TCTAATGAAAATGATGGTAGTGAAAATGATATGGACGAAGAAAATTCTAATGAAACAAAC
CAAGATAACATGCACTCTTAACACTAAACATTATCAGGCGAATAAAGCTTCAAAAAGACT
AAGAAATCCAAAGAATAAAAAATTTAAAGGAAGTAGTCGTTGAAGGTCAAAAAGCTAAAT
TCAATCAAACAAGAAAGCTAAATAGAAGAAGAGAATCAATAAGAAAGTCTAGTAAATAAT
GAAGAAAAATAAACCATGAATGAAGAAAATAATGAAGACTATATTGATGATGACGAAGAT
GATGACATGCTTGATGAAGAAGACGATGATATGATGGATGAATATGAATCTAATGAATCT
AGAAAACTTGAAAGCAACACTAATAACCCAAATGGTGAAAAGATTGTTCGTCCTAAATAC
AAAAATTCAAATTCCCCTTCAAATACAACCAAAAGGTGGTGGACAAAAGAAGAGGATGAA
CTCTTAAAAAACCTTGTAAAAGATCATGGTGCTAAAAATTGGAAAAAAATTGCTGGCTAT
TTTAAGGAACGCAGCGATGTTTAATGTTTACACAGATGGTAAAAAGTTTTAAATCCATCT
CTTGTTAAAGGGCCTTGGACCAAGGAAGAAGATGAAATAGTAACAAAATTAGTTCTTGAA
TAAGGCCCCAAAAATTGGAGTTCTATTGCCAAGCATTTACCTGGTCGTATTGGAAAACAA
TGCAGAGAAAGATGGCACAATCACTTAAATCCATACATCAAGAAAGACAGATGGACTGAG
GAAGAAGATCAAGCTATTATTGAAGCTCATAAAAGATTAGGAAATAGATGGGCTCTTATT
GCTAAGTATTTACCAGGCCGTACTGATAACGCAATCAAAAATCACTGGAATTCAACTATC
AAGAGAAAATTAAAAATGTAAAAGCGTGAAGAAGATTTAGAACCTCCCAAAAAGAAAAAT
TTAAATATTAAGGAAATAGAAGAAGAATTGTCAAATATGCCCTCAGTTAACTTATTAAAA
AATGAAGCTTATATGAAATAGTTCCATCTTTAAAATGCATAATATAATGAGGGAATTAAA
TAGCTCAATTCAGAATCAAATATTAATCACTCTAAAATGGAAGATAGAGATGATGATGAC
GACGAAGAAGATAGCGATGAAGAAAATTTATCAAATGAATAGCTCTCTTAACCTAATTTG
AATAACTCTAGAGCAAATAGCATCCAACTTCCTATGGTTTCTGTCAAGGAAGAAGAATAA
GAAACAACTTATAAGAAAAGTGCTATTCAATCATCTAAAGAAAAAGATACTATAAAGAAA
GAAGTAAAATAACGTAAAAAAGAAAAGGGAGAATTTATCACACCTGATAAAAAATCTAAT
TTCATTAGCTAAGAAACAACTGCTCCTACTACTTAAGCTGACAATCATTTACGCTCAATA
GAACAAAGAAATTAGTCATTTTTAAATAACGAAAATGATTTCGTCACACCTGTTAAACAC
TTAAACTTTTCAACTCCTAAAAACACTTAAGCAAATAAAGAAAAGTCAAATTTAAAATCT
GTATCTAATTAAAAAGAATCCTTCATACTGCATCCAAGCAAAAAAAGTCTCAATATAGTA
TTCCCTAATTTTACACTTAGTGACATATTAAAAATCGAAAACTCAGTCACTTTGATGAAG
ACACTACTCAGATAAGCAGAATTACCAGATCTTTCTACTTCTTATTAGTTTTTCGATTAA
TAATACAGCCAAGCATAGTCACCTTTAAGTTTTAGAGGAGCTAAAAATGACGAAAATAAC
AGCATGTATTTTGAAAAATCAGTTAACTAACTTTAAAGTTCAAGTAAAACAACATCACTC
TTACAAAACAATAATAATGCCATAAATATCCCCACTCCTACTTTATCTAAACCTAGCTCA
GGATTTAAACCTGTAGGATCTTCTATTACAAGTTTAAAAAGACCTCACCCAGATAAATTT
GATGGAATAAAAAAAGAGCTTTCCTTCACATCTCCATAAGAAAAATCAATAGTAATGAAA
AGTATAAATTCTTTTGGGACACCTGAAATGAGAGAAGAGCTATCAACAGCTTGA


>TTHERM_00842380(protein)
MHMIKSETQPEGNSIETKIEEGQQNSIQIVQEQQAQQLVASALDISNRQGGMRPQDQNFS
VEKSEGKQVVNKKEEAINEKQNKEQDAQQQISSIMHNQSQQQQQAEEDEFMKLKQLLEVI
KSKYNVQSDDVIKYALNNTSQLIQMPEGLKAASSDNNSNQPGKDLASTVINHLFSNSSIN
QNQIKNSQINAPIISSTSNSQLLLPTPLNSLNISANIHAAFQSKIEENESSACAYSVEPP
LRKKQNSKSSQKNVKKASMISNENDGSENDMDEENSNETNQDNMHSQHQTLSGEQSFKKT
KKSKEQKIQRKQSLKVKKLNSIKQESQIEEENQQESLVNNEEKQTMNEENNEDYIDDDED
DDMLDEEDDDMMDEYESNESRKLESNTNNPNGEKIVRPKYKNSNSPSNTTKRWWTKEEDE
LLKNLVKDHGAKNWKKIAGYFKERSDVQCLHRWQKVLNPSLVKGPWTKEEDEIVTKLVLE
QGPKNWSSIAKHLPGRIGKQCRERWHNHLNPYIKKDRWTEEEDQAIIEAHKRLGNRWALI
AKYLPGRTDNAIKNHWNSTIKRKLKMQKREEDLEPPKKKNLNIKEIEEELSNMPSVNLLK
NEAYMKQFHLQNAQYNEGIKQLNSESNINHSKMEDRDDDDDEEDSDEENLSNEQLSQPNL
NNSRANSIQLPMVSVKEEEQETTYKKSAIQSSKEKDTIKKEVKQRKKEKGEFITPDKKSN
FISQETTAPTTQADNHLRSIEQRNQSFLNNENDFVTPVKHLNFSTPKNTQANKEKSNLKS
VSNQKESFILHPSKKSLNIVFPNFTLSDILKIENSVTLMKTLLRQAELPDLSTSYQFFDQ
QYSQAQSPLSFRGAKNDENNSMYFEKSVNQLQSSSKTTSLLQNNNNAINIPTPTLSKPSS
GFKPVGSSITSLKRPHPDKFDGIKKELSFTSPQEKSIVMKSINSFGTPEMREELSTA


>TTHERM_00842380(gene)
ATGCATATGATCAAGAGTGAAACCTAGCCTGAAGGTAACTCAATTGAAACCAAAATCGAA
GAAGGCTAACAAAATAGCATTCAAATAGTTCAAGAGTAGTAAGCTTAGCAACTTGTTGCT
TCTGCCCTCGACATTTCTAATAGATAAGGTGGTATGAGACCTCAAGACCAGAATTTTTCA
GTAGAAAAGAGTAAATAAATTCACCATCAGTTTAATAACAACTATAATGATTTAATTAAT
CAAAAGGTGAAGGGAAATAAGTAGTAAATAAAAAGGAAGAAGCAATTAATGAAAAATAAA
ATAAAGAATAAGATGCCTAACAATAAATTAGCAGTATCATGCATAATTAATCCTAATAGT
AGTAGCAAGCAGAAGAGGATGAATTCATGAAACTCAAACAGCTATTAGAAGTTATTAAGA
GTAAGTATAATGTGCAATCAGATGATGTAATTAAATATGCTTTAAACAACACATCTCAAT
TAATTTAGATGCCAGAAGGATTAAAGGCTGCTTCTTCAGATAACAACAGCAACCAGCCTG
GCAAAGATTTGGCTTCAACAGTAATCAATCATCTCTTCTCTAACTCTTCTATAAATTAAA
ATCAAATTAAAAATTCTTAAATAAATGCTCCTATCATCTCTTCCACATCAAATTCTTAGT
TATTACTTCCAACACCTCTTAATTCCTTAAACATCTCCGCCAATATTCATGTAAATTATT
AACATAAGATCTTTTAAAACACTCTTCAAATTAATAAACGGTCTTTAATCGAGTTAGTTT
TATTATTTATTCAGCTCAGATCCTAATATTGCTTCTATTTAACGCATATTATTTTTTATT
TCTTTTCTTCTTTTCTCATTTCTTTGGACAGCAAGATAGATAGATTAATAGATACATTTC
TCTTGATTTAATTTTCTATTAATTTTTTGCTTCCTTTTTGCTTTAAAATTATCAAACTTC
TTTCCATATTTGATTACTCAACAAAAGTCTTGAAAGACTTTAGCAGAAAATTTTTTCAGT
TCTACATCCAATTTTTTACTTTATTATAAATTTTGCATCAATTAATAATTGCTTCCTATT
CGATGAACTCTTAGACATTTTTAATAAATTTTATTGCACCTTTGCACATAAGTAAATACA
GTCTTGACTGAATAAAACTAACAAACCGTTTCATCTTAAAATTTTATTTTAGGCTTAATC
TAATTTAATTTCTTAATTCATTTATTACTAGGCTGCATTTTAGTCTAAAATTGAAGAGAA
TGAATCTTCTGCTTGTGCTTATTCTGTTGAACCTCCTCTTAGAAAGAAATAAAATTCTAA
GAGCTCTTAGAAAAATGTTAAAAAGGCAAGCATGATATCTAATGAAAATGATGGTAGTGA
AAATGATATGGACGAAGAAAATTCTAATGAAACAAACCAAGATAACATGCACTCTTAACA
CTAAACATTATCAGGCGAATAAAGCTTCAAAAAGACTAAGAAATCCAAAGAATAAAAAAT
TTAAAGGAAGTAGTCGTTGAAGGTCAAAAAGCTAAATTCAATCAAACAAGAAAGCTAAAT
AGAAGAAGAGAATCAATAAGAAAGTCTAGTAAATAATGAAGAAAAATAAACCATGAATGA
AGAAAATAATGAAGACTATATTGATGATGACGAAGATGATGACATGCTTGATGAAGAAGA
CGATGATATGATGGATGAATATGAATCTAATGAATCTAGAAAACTTGAAAGCAACACTAA
TAACCCAAATGGTGAAAAGATTGTTCGTCCTAAATACAAAAATTCAAATTCCCCTTCAAA
TACAACCAAAAGGTGGTGGACAAAAGAAGAGGATGAACTCTTAAAAAACCTTGTAAAAGA
TCATGGTGCTAAAAATTGGAAAAAAATTGCTGGCTATTTTAAGGAACGCAGCGATGTTTA
ATGTTTACACAGATGGTAAAAAGTTTTAAATCCATCTCTTGTTAAAGGGCCTTGGACCAA
GGAAGAAGATGAAATAGTAACAAAATTAGTTCTTGAATAAGGCCCCAAAAATTGGAGTTC
TATTGCCAAGCATTTACCTGGTCGTATTGGAAAACAATGCAGAGAAAGGTATTTATTTAT
TTATCTTTGACATTTTGCAACAAAAACATAAAAAACAATTTACTCTCTTTTTGGATTTTA
TAAATGCGCGCTATTTTAATTAAACTTTTGCAAAAATTAAATAATAAAATTTAATAATTA
GATGGCACAATCACTTAAATCCATACATCAAGAAAGACAGATGGACTGAGGAAGAAGATC
AAGCTATTATTGAAGCTCATAAAAGGTAAAGAAATTAAGCCTACTTTAATATATAATTAA
AATAGAATTATTATTTGCTTCACAAAAAGTAGATTTCATTCAATAGATATTTTATTGAAT
AGTGTCTTATTTATTAGTATCTTTAAAACTGAGTGAGTGTGCATGCTTATCCAAAATTTC
TCACAAAAAAAAACAAAACACAGAAAACAAGATTTTAATTCGAAAAGGAACGTTAATAAT
TTTCTTAAGAAATTTAGCATACATAATTTTGTGGGAAAATTAACTATATTCGTAAAATTT
AACTTGGCACACAAAAATAAAATTAATTGACAAAACTAAACATATCTTTTATTTTTCCTC
TTTATTTTCAATGATTCTTTCAATTCTATTTAAACATAACACTAACTCTAACTCTTTTAT
TTTTATGAGAGATAAATTTTAATTAACTTTTCTGACATTCATTCAAATGTATCCATTAAA
AATTCATTGTTTGAATTCTTGAGTTAAGCAAGCACATAATACAAACAAACACAAATAAAT
AAAAACACTCGAAAAATTAAAATATATTTTTCTAATAAAATTTGATTCTTTTGCTAATAA
ATTCTAAATAGTCTTTAATTTTCTAGTTCGATTAACAAAAAAAAATTAATTCAACTTTTA
ATATTTATACAAAATAAATCCATTAATTGATTAATTCAATTCTATTTTAAATCTAATTTA
AATATTAACGCTTTGCTTTTAATACATAATTTTATATAAAAAAATAGATTAGGAAATAGA
TGGGCTCTTATTGCTAAGTATTTACCAGGCCGTACTGATAACGCAATCAAAAATCACTGG
AATTCAACTATCAAGAGAAAATTAAAAATGTAAAAGCGTGAAGAAGATTTAGAACCTCCC
AAAAAGAAAAATTTAAATATTAAGGAAATAGAAGAAGAATTGTCAAATATGCCCTCAGTT
AACTTATTAAAAAATGAAGCTTATATGAAATAGTTCCATCTTTAAAATGCATAATATAAT
GAGGGAATTAAATAGCTCAATTCAGAATCAAATATTAATCACTCTAAAATGGAAGATAGA
GATGATGATGACGACGAAGAAGATAGCGATGAAGAAAATTTATCAAATGAATAGCTCTCT
TAACCTAATTTGAATAACTCTAGAGCAAATAGCATCCAACTTCCTATGGTTTCTGTCAAG
GAAGAAGAATAAGAAACAACTTATAAGAAAAGTGCTATTCAATCATCTAAAGAAAAAGAT
ACTATAAAGAAAGAAGTAAAATAACGTAAAAAAGAAAAGGGAGAATTTATCACACCTGAT
AAAAAATCTAATTTCATTAGCTAAGAAACAACTGCTCCTACTACTTAAGCTGACAATCGT
AATATTAAAAAAATAAAAATATAGCTAAATATTAATTAAATCATATTTAAAATTATATTA
GATTTACGCTCAATAGAACAAAGAAATTAGTCATTTTTAAATAACGAAAATGATTTCGTC
ACACCTGTTAAACACTTAAACTTTTCAACTCCTAAAAACACTTAAGCAAATAAAGAAAAG
TCAAATTTAAAATCTGTATCTAATTAAAAAGGTATATTTAAAGTTATTTCCTTAAATTAT
TTTAATACTTATTTTCTAACTCAATAAGAATCCTTCATACTGCATCCAAGCAAAAAAAGT
CTCAATATAGTATTCCCTAATTTTACACTTAGTGACATATTAAAAATCGAAAACTCAGTC
ACTTTGATGAAGACACTACTCAGATAAGCAGAATTACCAGATCTTTCTACTTCTTATTAG
TTTTTCGATTAATAATACAGCCAAGCATAGTCACCTTTAAGTTTTAGAGGAGCTAAAAAT
GACGAAAATAACAGCATGTATTTTGAAAAATCAGTTAACTAACTTTAAAGTTCAAGTAAA
ACAACATCACTCTTACAAAACAATAATAATGCCATAAATATCCCCACTCCTACTTTATCT
AAACCTAGCTCAGGATTTAAACCTGTAGGATCTTCTATTACAAGTTTAAAAAGACCTCAC
CCAGATAAATTTGATGGAATGTATGCCAATTAATTTTAATTATTAGAAGAAAAAGTTAAT
TTAATTTTATTTTTTAAAAAAGAAAAAAAGAGCTTTCCTTCACATCTCCATAAGAAAAAT
CAATAGTAATGAAAAGTATAAATTCTTTTGGGACACCTGAAATGAGAGAAGAGCTATCAA
CAGCTTGA