Identifiers and Description

Gene Model Identifier

TTHERM_00840150

Standard Name

None

Aliases

PreTt17830 | 146.m00131 | 3743.m00060

Description

RNA methyltransferase, TrmH family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00023 ) Ankyrin repeat
  • ( PF00588 ) RNA methyltransferase, TrmH family
  • ( TIGR00186 ) RNA methyltransferase, TrmH family, group
  • ( PF08032 ) RNA 2'-O ribose methyltransferase substrate

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.6%

TetraMine Data

TTHERM_00840150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41325.19.997093137033517e-262hypothetical protein (291 aa)
OxytrichaContig12780.0.g531.0002335610448659e-38SpoU rRNA Methylase family
SGDYOR201C2.0008113830639685e-30MRM1 Ribose methyltransferase
that modifies a functionally c
ritical, conserved nucleotide
in mitochondrial 21S rRNA
DictyBaseDDB_G02774791.000382677035467e-28DDB_G0277479 on chromosome: 2
position 8152464 to 8154059
WormBaseWBGene000128649.995317835403734e-19status:Partially_confirmed U
niProt:Q9XWY8 protein_id:CAA
21494.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00840150(coding)
ATGTTTAAAGTATTTAAGTCACAAAATAATTTCAATAGCTTAAGCAGCTCACTTATGAGC
TTATTTTCTACTTAGAAGTCATCAAAGTTTGATTTTGTTTATGGATTAAATCCTACTATG
ATCGCTCTCCATTCAAATAAAAGAAATATTGTCGAAGTTATAATTAATCAACATGTCTAA
AGTCATCTTCCTCCCAAAATTTCGAATATCATAAATACAGCTAATGCAAAAAAAATACCA
GTTAAGTTTGTTGATAGAGAAAAATTAGACAGATTGGTTTAAAATTAACCACACTAAAAC
GTAGTTATTAAAGCTGAACCTTTAAAATATTTAAGAACAAAATCTAGTGATATTTTATAA
GGGAATATGATTCTATTCCTTGATAGAATCACAGATCCTTAGAATTTTGGTGCTATAATA
AGAACATGTTAATATCTAGGAGTGGATAACGTAGTAGTAGATGAATTCTCAAGATGTCCT
TTAAATCCAACAGTTTCTAAGACAAGCTCAGGAGCTTTAGAAGTGATGGACATTTATTGT
ACCCCAGATCCAGTTGAGTTTTTAAAAGATTGCTAACTAAGAGGATGGAAAGTCTACTCA
ACCGGTTTAAATCATTCTGAAAACTAGATTTCTCTTGAAAAATTAAAAGTTAGTTCAAAA
GATAAAATAGTCCTTGTTATGGGTAACGAAGGTAATGGTGTTGATCCTAAAATACTTAAA
GTCAGTGATAAAATTGTTTCTATTGATTAAACCCTTTATTTAAACCGTCCTATGGTTTTC
CCATACACTTTAATCGATTCTTTAAATGTAAACTCTGCTACATCTATTTTAATTTAAAAC
ATCAAACTTAAAATGATAGCATCTGAAAAAATGATATGA


>TTHERM_00840150(protein)
MFKVFKSQNNFNSLSSSLMSLFSTQKSSKFDFVYGLNPTMIALHSNKRNIVEVIINQHVQ
SHLPPKISNIINTANAKKIPVKFVDREKLDRLVQNQPHQNVVIKAEPLKYLRTKSSDILQ
GNMILFLDRITDPQNFGAIIRTCQYLGVDNVVVDEFSRCPLNPTVSKTSSGALEVMDIYC
TPDPVEFLKDCQLRGWKVYSTGLNHSENQISLEKLKVSSKDKIVLVMGNEGNGVDPKILK
VSDKIVSIDQTLYLNRPMVFPYTLIDSLNVNSATSILIQNIKLKMIASEKMI


>TTHERM_00840150(gene)
CTTTGATAAATCAAGTTTAATTATTAAGATATAATAAATAGAATTAAAAAGTAGAAGGTT
AGAAAAAATGTTTAAAGTATTTAAGTCACAAAATAATTTCAATAGCTTAAGCAGCTCACT
TATGAGCTTATTTTCTACTTAGAAGTCATCGTAATCACATTTTTATATCTTAAGTACTAA
TTAATCTAAAGATATATTTTTTATTTTAAAAGAAAGTTTGGTAGAATATTCATTTACATA
GTGAGTTAACATAATTAATTATCTTAAATACTTTTTAGATTTTGTTTATGGATTAAATCC
TACTATGATCGCTCTCCATTCAAATAAAAGAAATATTGTCGAAGTTATAATTAATCAACA
TGTCTAAAGTAATAGAATTTTCTAAAATTAATTTCAAAGGAATCTCTAATTTTTGTTCAA
ATGTATTATTTTTATAAATAAAAAGGTCATCTTCCTCCCAAAATTTCGAATATCATAAAT
ACAGCTAATGCAAAAAAAATACCAGTTAAGTTTGTTGATAGAGTAATTTCTATTTAAAAC
CAGAATCTCTTATTTAGTTAAAAATAACTTTTTAAAATAGGAAAAATTAGACAGATTGGT
TTAAAATTAACCACACTAAAACGTAGTTATTAAAGCTGAACCTTTAAAATATTTAAGAAC
AAAATCTAGTGATATTTTATAAGGGAATATGATTCTATTCCTTGATAGAATCACAGATCC
TTAGAATTTTGGTGCTATAATAAGAACATGTTAATATCTAGGAGTGGATAACGTAGTAGT
AGATGAATTCTCAAGATGTCCTTTAAATCCAACAGTTTCTAAGACAAGCTCAGGAGCTTT
AGAAGTGATGGACATTTATTGTACCCCAGATCCAGTTGAGTTTTTAAAAGGTTACTTTTA
TTTCAATATTATATCAGCTAAAACAATTAAATATAGATTGCTAACTAAGAGGATGGAAAG
TCTACTCAACCGGTTTAAATCATTCTGAAAACTAGATTTCTCTTGAAAAATTAAAAGTTA
GTTCAAAAGTAGATTTTATAAAATTTTGTTATTTTATTTATTCATTCAATTTAATTCATA
TAAAAGGATAAAATAGTCCTTGTTATGGGTAACGAAGGTAATGGTGTTGATCCTAAAATA
CTTAAAGTCAGTGATAAAATTGTTTCTATTGATTAAACCCTTTATTTAAACCGTCCTATG
GTTTTCCCATACACTTTAATCGATTCTTTAAATGTAAACTCTGCTACATCTATTTTAATT
TAAAACATCAAACTTAAAATGATAGCATCTGAAAAAATGATATGATAGAATTATTTATAT
TTGCATTTATATAACTAAGGATTAA