Identifiers and Description

Gene Model Identifier

TTHERM_00837980

Standard Name

CDK6 (Cyclin Dependent Kinase 6)

Aliases

PreTt17811 | 146.m00112 | 3743.m00043

Description

Protein kinase domain containing protein; sequence similarity to the CDKL protein kinase family; involved in DNA replication

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF01519 ) Protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00837980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19538.16.000921370366457e-140hypothetical protein (659 aa)
OxytrichaContig2395.0.g830.000000000000001999258566166494Leucine Rich repeat
DictyBaseDDB_G02904850.0000000000000299873730555305dlrA on chromosome: 5 position
4410371 to 4413091

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00837980(coding)
ATGAATTATGAAATTTAAAATTAAGAGAGTTACTATTTGTATCTATCAAGCACATATGGA
GCAGAGTTTATTGAAACTAAGCTTTCCTTACATAGCAATATTAGAAAATTAAAATTAGTA
TTAAATACAAATGATAAGGAAGGTATAAATTAGTTAGGATTGCAACTTACAAATTTAAAT
CATTTACTAGAATTAACCATCATTATTTAAGAAGAGAGTTGCTTTAATGAAAACATTTTA
CAAGATTTTTTTTAATATTTCTAATAACTGAAAAATTTAGTCAAATTGGAAGTAAATGTT
GCTAGATAAAGCCCCTTTTAAGAATAAAGATCTTCATATTTATCTAACGCTATTTAAAAT
TTAGTAAATTTAGAGAGTCTTATTATAAATTTCGAAGGAGAAAATAACCTATCTTAAAAT
GGAGCTTCTGCTATTGGATATTGCTTAAGATATTTGAAGAAACTCAATAATTTAAATTTA
TAAATTGGTTATGATTTTATAGGAAAATAAGGATGCGAAAAATTAGCTGATGGAATTGCT
CATCTTATTAATTTACAATAATTGACTATTTCTATTAGAGAGTATAATTTAATAGAAAGT
GGATCTATTTAGCTTGGAAAAAGCTTAGAGAATTTAACTAATTTGAGCTATTTAAAACTA
AATATAGAAATGGATAACTAAATAGAATCTCAAGGTGCTATAGCTTTAGCAAAAGGAATT
TCAAGTCTTACTAATTTGAATCGTTTGGAACTCTTAATAGGTTATAATAATAATATTGGC
TAGTAGGGAGCAATTAGCCTAGGAAATGCGCTTATAAAATTGAAAAGTTTAGACTATCTT
GAACTAATTATTTCTGGTGGAAATGAAATTTAATTCAAAGGTGCTTAGGGTATTGCAGAA
GGTTTAAAGGCTTTAAAAAATCTAAAAGATCTTAAATTAAATATTCTAGGAGATAATTAA
TTAGGATAAAAAGGTTCTACTTCGATAATCAAATCATTATCTTATCTTAAAAATCTAGAA
AACTTAGAATTTGATATTGGTGAAGTTGATTATATTGAAAAAGAAGGGGCAATACAACTT
GGAAAGTCAATTTAACAAATGAAAAATTTAAATAATTTAAATTTATGGATCCATGACTGT
AATGATATTTAGCAAGGAGGCGCTAAATCAATTGGCTAAGGATTATCTCATCTTTCAAAT
TTGAAATTTCTTAATTTGAATATCTTTTCTGTAAATCAAATAGGCCCTAAAGGTATTCAA
GCAATAGCAAATGGTATAAAATGTTCAAAAAACATGGAGAGTCTATCTCTGTGGATAGAT
CATGATAACTAAATAGGTAGTTAAGGATGTATCTTTATTGGAGAGTCACTATGTCATTTA
AAAGATTTAAAAACTTTAAACATTGATATTGGTGTTTATTCAAAAGTAGGGAAAGAGGGA
ATAATAGGATTATCTCAGTGCTTTAAATATCTCAATTAATTATAAGACCTAAATTTTAGC
ATAAAAGGTTATAATAATTTGACATAAGAAGGGTTTTAATAATTCTCAATCAATATGAAA
AGTTTAGTCAATTTAAAAATATTAGGATTATACTTTGGTAGCAGAAATTAAATAGGTGGG
TAAGGAATGAGTTATTTAGGTCAATAGCTTTTACATTTATAAAATTTAAATAAGTTTTCA
CTTGGTTTAGGAGAAGAAAATAAATTATCTGAAAATTCTCTAAAAAATTTTGGTGAAAGT
TTTAATCATATAAATAGTTTAACTCATATTGATTTAGATATTTATAAACATAATTTGAAA
AATAATGATTTCGGGAATATAGGAAATGCTTTGAGTATGTGCAAAAAACTTTAATTCCTA
AAAATAAAAGTAGATTAAGAACATTAAATAACTTAAAACAACATAAAATTATTTGCTAAT
AACCTCAGTTAGAATAAAACTGTCATTTAAATTAAATATTCTCTTAATTTGGATAGAGAG
GACCCAGACGATTATGGAAATTAAGATGAAGAGGATGAGGAAATAGAAGATGATCTTGAA
GAGGAAAATAATGAAATTTTAGATGAAGAGAATAGCTTATAGAATGACTAAGTAAAAGAA
GAAGATGAAGATATAGACAAAGAAGGCGATGATATGAAAGAAGATGAAAACTTATCAGAA
AATGAAGGCAATTATCAAAAAGATGATGAAGAATTTGATAAAGAAGATTTGGAAAATATG
GATATATAAGAATTTTAATAGGATATGAGTTATTTAGGAAACCAAAACAGTCAAAGTGAG
ATATCAAATTAACAATAAATTTAGGATTTAGATGCTTTTGCTAAAAAATTATTTATAAGA
AAAATAAAATAATTAGTTAATTTAATTCATTGA


>TTHERM_00837980(protein)
MNYEIQNQESYYLYLSSTYGAEFIETKLSLHSNIRKLKLVLNTNDKEGINQLGLQLTNLN
HLLELTIIIQEESCFNENILQDFFQYFQQLKNLVKLEVNVARQSPFQEQRSSYLSNAIQN
LVNLESLIINFEGENNLSQNGASAIGYCLRYLKKLNNLNLQIGYDFIGKQGCEKLADGIA
HLINLQQLTISIREYNLIESGSIQLGKSLENLTNLSYLKLNIEMDNQIESQGAIALAKGI
SSLTNLNRLELLIGYNNNIGQQGAISLGNALIKLKSLDYLELIISGGNEIQFKGAQGIAE
GLKALKNLKDLKLNILGDNQLGQKGSTSIIKSLSYLKNLENLEFDIGEVDYIEKEGAIQL
GKSIQQMKNLNNLNLWIHDCNDIQQGGAKSIGQGLSHLSNLKFLNLNIFSVNQIGPKGIQ
AIANGIKCSKNMESLSLWIDHDNQIGSQGCIFIGESLCHLKDLKTLNIDIGVYSKVGKEG
IIGLSQCFKYLNQLQDLNFSIKGYNNLTQEGFQQFSINMKSLVNLKILGLYFGSRNQIGG
QGMSYLGQQLLHLQNLNKFSLGLGEENKLSENSLKNFGESFNHINSLTHIDLDIYKHNLK
NNDFGNIGNALSMCKKLQFLKIKVDQEHQITQNNIKLFANNLSQNKTVIQIKYSLNLDRE
DPDDYGNQDEEDEEIEDDLEEENNEILDEENSLQNDQVKEEDEDIDKEGDDMKEDENLSE
NEGNYQKDDEEFDKEDLENMDIQEFQQDMSYLGNQNSQSEISNQQQIQDLDAFAKKLFIR
KIKQLVNLIH


>TTHERM_00837980(gene)
ATGAATTATGAAATTTAAAATTAAGAGAGTTACTATTTGTATCTATCAAGCACATATGGA
GCAGAGTTTATTGAAACTAAGCTTTCCTTACATAGCAATATTAGAAAATTAAAATTAGTA
TTAAATACAAATGATAAGGAAGGTATAAATTAGTTAGGATTGCAACTTACAAATTTAAAT
CATTTACTAGAATTAACCATCATTATTTAAGAAGAGAGTTGCTTTAATGAAAACATTTTA
CAAGATTTTTTTTAATATTTCTAATAACTGAAAAATTTAGTCAAATTGGAAGTAAATGTT
GCTAGATAAAGCCCCTTTTAAGAATAAAGATCTTCATATTTATCTAACGCTATTTAAAAT
TTAGTAAATTTAGAGAGTCTTATTATAAATTTCGAAGGAGAAAATAACCTATCTTAAAAT
GGAGCTTCTGCTATTGGATATTGCTTAAGATATTTGAAGAAACTCAATAATTTAAATTTA
TAAATTGGTTATGATTTTATAGGAAAATAAGGATGCGAAAAATTAGCTGATGGAATTGCT
CATCTTATTAATTTACAATAATTGACTATTTCTATTAGAGAGTATAATTTAATAGAAAGT
GGATCTATTTAGCTTGGAAAAAGCTTAGAGAATTTAACTAATTTGAGCTATTTAAAACTA
AATATAGAAATGGATAACTAAATAGAATCTCAAGGTGCTATAGCTTTAGCAAAAGGAATT
TCAAGTCTTACTAATTTGAATCGTTTGGAACTCTTAATAGGTTATAATAATAATATTGGC
TAGTAGGGAGCAATTAGCCTAGGAAATGCGCTTATAAAATTGAAAAGTTTAGACTATCTT
GAACTAATTATTTCTGGTGGAAATGAAATTTAATTCAAAGGTGCTTAGGGTATTGCAGAA
GGTTTAAAGGCTTTAAAAAATCTAAAAGATCTTAAATTAAATATTCTAGGAGATAATTAA
TTAGGATAAAAAGGTTCTACTTCGATAATCAAATCATTATCTTATCTTAAAAATCTAGAA
AACTTAGAATTTGATATTGGTGAAGTTGATTATATTGAAAAAGAAGGGGCAATACAACTT
GGAAAGTCAATTTAACAAATGAAAAATTTAAATAATTTAAATTTATGGATCCATGACTGT
AATGATATTTAGCAAGGAGGCGCTAAATCAATTGGCTAAGGATTATCTCATCTTTCAAAT
TTGAAATTTCTTAATTTGAATATCTTTTCTGTAAATCAAATAGGCCCTAAAGGTATTCAA
GCAATAGCAAATGGTATAAAATGTTCAAAAAACATGGAGAGTCTATCTCTGTGGATAGAT
CATGATAACTAAATAGGTAGTTAAGGATGTATCTTTATTGGAGAGTCACTATGTCATTTA
AAAGATTTAAAAACTTTAAACATTGATATTGGTGTTTATTCAAAAGTAGGGAAAGAGGGA
ATAATAGGATTATCTCAGTGCTTTAAATATCTCAATTAATTATAAGACCTAAATTTTAGC
ATAAAAGGTTATAATAATTTGACATAAGAAGGGTTTTAATAATTCTCAATCAATATGAAA
AGTTTAGTCAATTTAAAAATATTAGGATTATACTTTGGTAGCAGAAATTAAATAGGTGGG
TAAGGAATGAGTTATTTAGGTCAATAGCTTTTACATTTATAAAATTTAAATAAGTTTTCA
CTTGGTTTAGGAGAAGAAAATAAATTATCTGAAAATTCTCTAAAAAATTTTGGTGAAAGT
TTTAATCATATAAATAGTTTAACTCATATTGATTTAGATATTTATAAACATAATTTGAAA
AATAATGATTTCGGGAATATAGGAAATGCTTTGAGTATGTGCAAAAAACTTTAATTCCTA
AAAATAAAAGTAGATTAAGAACATTAAATAACTTAAAACAACATAAAATTATTTGCTAAT
AACCTCAGTTAGAATAAAACTGTCATTTAAATTAAATATTCTCTTAATTTGGATAGAGAG
GACCCAGACGATTATGGAAATTAAGATGAAGAGGATGAGGAAATAGAAGATGATCTTGAA
GAGGAAAATAATGAAATTTTAGATGAAGAGAATAGCTTATAGAATGACTAAGTAAAAGAA
GAAGATGAAGATATAGACAAAGAAGGCGATGATATGAAAGAAGATGAAAACTTATCAGAA
AATGAAGGCAATTATCAAAAAGATGATGAAGAATTTGATAAAGAAGATTTGGAAAATATG
GATATATAAGAATTTTAATAGGATATGAGTTATTTAGGAAACCAAAACAGTCAAAGTGAG
ATATCAAATTAACAATAAATTTAGGATTTAGATGCTTTTGCTAAAAAATTATTTATAAGA
AAAATAAAATAATTAGTTAATTTAATTCATTGA