Identifiers and Description

Gene Model Identifier

TTHERM_00836640

Standard Name

None

Aliases

PreTt17776 | 146.m00077 | 3743.m00009

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00836640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_37770
Tetrahymena borealisEI9_19564.19.997093137033517e-262hypothetical protein (629 aa)
OxytrichaContig13512.0.g609.997093137033517e-262WD domain, G-beta repeat
WormBaseWBGene000030092.9990241513684e-21locus:lin-23 F-box/WD repeat
-containing protein lin-23 s
tatus:Confirmed UniProt:Q099
90 protein_id:CCD66391.1
DictyBaseDDB_G02864574.999245259173412e-21strap on chromosome: 4 positio
n 4462466 to 4463679
SGDYCR072C1.999598840915195e-17RSA4 WD-repeat protein involve
d in ribosome biogenesis; may
interact with ribosomes; requi
red for maturation and efficie
nt intra-nuclear transport or
pre-60S ribosomal subunits, lo
calizes to the nucleolus

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00836640(coding)
ATGGATAACGTTTCAGAAGCATCATTATAGGAAGATTCAATTATTGAATTAGAGCATGCT
ATTGGTTTTAGCGGAAAGATTCCAAGATGTGTCTATTTCCATCCTAATGGTTAAGATTTT
GTATATATATCTGGCGCTTGCATAGTTATCACAGATTTAAAGGATCCTCATAAGCAAAGC
TTTTTAAGAGGTCATGATAATTAAATAACATGCTTAGCAATATCAAATAATGGTAAATTA
GTAGCTTCAGGATAACTAGGTGATAACTCTGATGTAATTATTTGGGATTTCTAATACAGG
AAACTTAGATTTAAATTATCCGAACACGATCATGAAGTTGCTATAGTTTAATTTTCAGAT
GATGACAGATTACTATTTAGCTGTGGAAATCCATCAGATAAAAAGATATTTATATGGAAT
ACGATAAATGGGTGTATTGTAGCTAGTTGTTAAATATATCCTGAAAAGATTATTGCAATG
AGATGGGGTGGATTCGCTAAAGATATAAAGCTTAGAGATACAAATAAATATTAATTTGCA
ACTGCAGGAAATAAATAGATATGCGTTTGGAAATTGGATGCTCAATTAGGATAGATTTAG
CATGAATTTATTAACACAGGATCAGTAATTAGAGAATACAGATGTCTAGAATTCTCCAAA
AATCGTGAGGATTATTTATTTGCAGGAACATCATCTGGTGATTTTCTATGCTTTTAAATG
AAAAATAAAGTATTAGCAGCTGTGATTACAGTCTCCGCTTAAGGAGTTCAGAGCATACAA
GCTGTAAATCCATCTCTGATTTTAGTTGGATGTGGTAATGGTATTATAAATTTATTTAAA
ACCGATGGAAACTAAATTGATTCTGTTGTTAAGAATTAAATTATTGGCAGTGTTAACAGT
ATTTCTTGCTCACCTAACTTATAAGAGTGTATGTGTGCAACAGATAGAGGTTTTATTTAC
AGAATTAGAAACACAGACCTTGCTAAGATTTTACATTGTGAAAACCATACAGATTCTGTT
GTATTTTTAACTTATCCTCCAGGTATATCTGATAAATTTGCATCTTGCAGTGAAGATGGC
TCTATTCGTTTATGGGATATAGGATCAGATTACGTCGTAACCACTAGATGCTTTGCTAAT
AATGCAGGATCTCCTTTATGTCTAACCTATAATAGCGAAATAGTGTTGAGCGGTTGGTAG
GATGGCAAAATTCGTATGTTTTCAAGTGAAAATGGTAACATAATTTGGTAAATGGATAAT
GCCCATAAAGATGGTGTTTATAGTATTTGCCTAAGTAAAAATTTTAAATTCTTCTGTTCT
GGAGGCTGTGATGGTGAAGTTAGAGTATGGGAAATGCGTTCAAGAGAAATGCTTTCTCAT
CTTAAAGAGCATACTTCAAAAGTAACTAAAGTCAAGCTTTTAGGAGAAAATGAAAGCTAA
GTTGTGTCATCATCCAAAGATAGAGCTCTTTTATCATGGGATTTAAAACAACAAAAAAGA
ATAAGTGCTCATATTTAACGTATGGGTGGTATAAATTCATTTGATATTGCTAATGATAAT
CAAACAGTAGTTACAACTGGTTAAGATAGAAAAATAACTTACTGGAATTTAAATTAAGCA
AATCCAATCAGAATATTAGATACAAACAATAACCCTAAGGCTGCAGACGAATGTATGTCT
CTCCACTTATCAAGTGATGGTAGATATTTTGTTACTGGAGGCTCAGAGCAAATAGTAAAA
GTTTGGGATTTTGCAACTGGTAAATTGATAGCTTAAGGCCGTGGACATTCAGGCTGCATT
AACACTGTTACCTTCTCACCTGATTGCAAGTAAGTAATTTCAGGAGGAAGAGATGGAAAT
ATATTAGTGTGGAATATATTTGACTGA


>TTHERM_00836640(protein)
MDNVSEASLQEDSIIELEHAIGFSGKIPRCVYFHPNGQDFVYISGACIVITDLKDPHKQS
FLRGHDNQITCLAISNNGKLVASGQLGDNSDVIIWDFQYRKLRFKLSEHDHEVAIVQFSD
DDRLLFSCGNPSDKKIFIWNTINGCIVASCQIYPEKIIAMRWGGFAKDIKLRDTNKYQFA
TAGNKQICVWKLDAQLGQIQHEFINTGSVIREYRCLEFSKNREDYLFAGTSSGDFLCFQM
KNKVLAAVITVSAQGVQSIQAVNPSLILVGCGNGIINLFKTDGNQIDSVVKNQIIGSVNS
ISCSPNLQECMCATDRGFIYRIRNTDLAKILHCENHTDSVVFLTYPPGISDKFASCSEDG
SIRLWDIGSDYVVTTRCFANNAGSPLCLTYNSEIVLSGWQDGKIRMFSSENGNIIWQMDN
AHKDGVYSICLSKNFKFFCSGGCDGEVRVWEMRSREMLSHLKEHTSKVTKVKLLGENESQ
VVSSSKDRALLSWDLKQQKRISAHIQRMGGINSFDIANDNQTVVTTGQDRKITYWNLNQA
NPIRILDTNNNPKAADECMSLHLSSDGRYFVTGGSEQIVKVWDFATGKLIAQGRGHSGCI
NTVTFSPDCKQVISGGRDGNILVWNIFD


>TTHERM_00836640(gene)
ATGGATAACGTTTCAGAAGCATCATTATAGGAAGATTCAATTATTGAATTAGAGCATGCT
ATTGGTTTTAGCGGAAAGATTCCAAGATGTGTCTATTTCCATCCTAATGGTTAAGATTTT
GTATATATATCTGGCGCTTGCATAGTTATCACAGATTTAAAGGATCCTCATAAGCAAAGC
TTTTTAAGAGGTCATGATAATTAAATAACATGCTTAGCAATATCAAATAATGGTAAATTA
GTAGCTTCAGGATAACTAGGTGATAACTCTGATGTAATTATTTGGGATTTCTAATACAGG
AAACTTAGATTTAAATTATCCGAACACGATCATGAAGTTGCTATAGTTTAATTTTCAGAT
GATGACAGATTACTATTTAGCTGTGGAAATCCATCAGATAAAAAGATATTTATATGGAAT
ACGATAAATGGGTATATTTAGTTATTTCTTTTTTGAAAAATAAATAGATTTATATGTCCA
TAAATAAATTAGAAATTATTGCGATGCATCTATTCAATCTTTTTTTAAATATTTTCAAAA
TGAAAATGAGTTTAAAAGTGAATAATAATGTAAAATTGACTAATTTATTTGTTAATAAAT
AGGTGTATTGTAGCTAGTTGTTAAATATATCCTGAAAAGATTATTGCAATGAGATGGGGT
GGATTCGCTAAAGATATAAAGCTTAGAGATACAAATAAATATTAATTTGCAACTGCAGGA
AATAAATAGATATGCGTTTGGAAATTGGATGCTCAATTAGGATAGATTTAGCATGAATTT
ATTAACACAGGATCAGTAATTAGAGAATACAGATGTCTAGAATTCTCCAAAAATCGTGAG
GATTATTTATTTGCAGGAACATCATCTGGTGATTTTCTATGCTTTTAAATGAAAAATAAA
GTATTAGCAGCTGTGATTACAGTCTCCGCTTAAGGAGTTCAGAGCATACAAGCTGTAAAT
CCATCTCTGATTTTAGTTGGTAAGCATTATAAAATATTTCAATTCTATAAAATTGTTTTT
TATTAACATATTTTGTATTTACTAAAAGGATGTGGTAATGGTATTATAAATTTATTTAAA
ACCGATGGAAACTAAATTGATTCTGTTGTTAAGAATTAAATTATTGGCAGTGTTAACAGT
ATTTCTTGCTCACCTAACTTATAAGAGTGTATGTGTGCAACAGATAGAGGTTTTATTTAC
AGAATTAGAAACACAGACCTTGCTAAGGTAATATAATAAATACTTAACAGAAAAGAATGA
TTCAATATTAAAATAATTAATCGTTATTATTAAATAGATTTTACATTGTGAAAACCATAC
AGATTCTGTTGTATTTTTAACTTATCCTCCAGGTATATCTGATAAATTTGCATCTTGCAG
TGAAGATGGCTCTATTCGTTTATGGGATATAGGATCAGATTACGTCGTAACCACTAGATG
CTTTGCTAATAATGCAGGATCTCCTTTATGTCTAACCTATAATAGCGAAATAGTGTTGAG
CGGTTGGTAGGATGGCAAAATTCGTATGTTTTCAAGTGAAAATGGTAACATAATTTGGTA
AATGGATAATGCCCATAAAGATGGTGTTTATAGTATTTGCCTAAGTAAAAATTTTAAATT
CTTCTGTTCTGGAGGCTGTGATGGTGAAGTTAGAGTATGGGAAATGCGTTCAAGAGAAAT
GCTTTCTCATCTTAAAGAGCATACTTCAAAAGTAACTAAAGTCAAGCTTTTAGGAGAAAA
TGAAAGCTAAGTTGTGTCATCATCCAAAGATAGAGCTCGTAATTAATACATTTATTTATT
TATGATTAGATTTTACTAAAAATATAAATTTTATTAATTAAAGTAAAAATTAACTTAAAA
AATAAAATGTAAGTTTTAAAGATTGACTTGTATTAATTGGAATAAAAATTTAAAAAAGCT
GAACTTTTAAAGTGAAGTCAAAATGTTATATTTAAAAAACAAAATTTATTTTATAAAACA
GTTTTATCATGGGATTTAAAACAACAAAAAAGAATAAGTGCTCATATTTAACGTATGGGT
GGTATAAATTCATTTGATATTGCTAATGATAATCAAACAGTAGTTACAACTGGTTAAGAT
AGAAAAATAACTTACTGGAATTTAAATTAAGCAAATCCAATCAGAATATTAGATACAAAC
AATAACCCTAAGGCTGCAGACGAATGTATGTCTCTCCACTTATCAAGTGATGGTAGATAT
TTTGTTACTGGAGGCTCAGAGCAAATAGTAAAAGTTTGGGATTTTGCAACTGGTAAATTG
ATAGCTTAAGGCCGTGGACATTCAGGCTGCATTAACACTGTTACCTTCTCACCTGATTGC
AAGTAAGTAATTTCAGGAGGAAGAGATGGAAATATATTAGTGTGGAATATATTTGACTGA