Identifiers and Description

Gene Model Identifier

TTHERM_00835390

Standard Name

None

Aliases

PreTt24554 | 145.m00121

Description

GCC2 and GCC3 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03128 ) CXCXC repeat
  • ( PF07699 ) GCC2 and GCC3
  • ( PF08790 ) LYAR-type C2HC zinc finger
  • ( PF03940 ) Male specific sperm protein
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF02420 ) Insect antifreeze protein repeat
  • ( PF00053 ) Laminin EGF-like (Domains III and
  • ( PF05001 ) RNA polymerase Rpb1 C-terminal repeat
  • ( PF01826 ) Trypsin Inhibitor like cysteine rich

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 76.4%

TetraMine Data

TTHERM_00835390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21152.13.001416859614811e-48hypothetical protein (841 aa)
OxytrichaContig4658.0.g22.9990241513684e-21GCC2 and GCC3
DictyBaseDDB_G02857610.000000005997038937208364DDB_G0285761 on chromosome: 4
position 3436262 to 3437972
WormBaseWBGene000185470.00000006998394348458725locus:clec-78 status:Partial
ly_confirmed UniProt:Q20531
protein_id:CCD71377.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00835390(coding)
ATGAGAAAAATAAACATTTGCCTCGTTCTTTTTGTGCTATTCTAGGTCTCCTTTTAGTAC
TGTCACTATTCAATTTAAAATAATAATGGTTAATGCAATTGCTTTGGTGGATTTTATGCT
AACTCTGCTAATTGTTTAGTATGCCCAAATAATGGATTAAGTTTAGGAGGATCTATTTCA
ATATCAGATTGCAAATATTGTAACTCTAATTCATACTATTTGGATTAGGCAGCAACAGAT
TCTTAAGGTTCAGTGTGCTTATTATGCCCTAATAACTCCTAGACTCAAACTAATTATCCT
TAGGGACCTCAAGATATTAGTGATTGTAATATTTGCTAACCTGGTTATTATCTTTAGACC
CCAGCAGTTCCACCTTAAAATGGTAATCCTGGCTAAGCTGCAGTTTGCGTTCCGTGCCCA
AATAATACAACAAGTAAAATGGGTCCAAATCCTACTTCAATCTCTTAATGTGATTCATGC
TAAAATGGGTTTTATATTTCTTAGCAAGCAACAGATTCCCAACCAGCAATTTGTTCACCT
TGTCCTATTAATACGACAAATAGCTACGATGAACCTTCTAATTTTTAATATAATATTAAT
GATTGCACTTCATGTATGCCTGGCTATTATAATTCTAATCAAAACTTTAATTAACCACCT
ATGTGTGTATAATGTCCTCCAAATACATTTAATTACATTACAGGTTCTTTTTCAATTTCA
ACTTGTACTTGTATGGAAAACTCCTATATGACAGTTCAGTCAACAAATAATTCTGCTCCA
ACTTGTTTGCCATGTCCTAATGGTTCAGGAAACTATTAACCACCTTTATTAGCTGGAGAT
TAATCTCAATGCGACATTTGCTAAGCGGGTTACTACGCATCCACGCCATATGCAGATCCT
ACAAATGGAAATCCAGGAATTGCATCCTAGTGCCACCAATGTCCAAATAATTCTTATTCT
GACCCCGGACTTTCATTTTATGAATCAAGTTGTTATAAGTGCAAACTTAATTATTACATG
AAAACCGCTCCCGCACTAGGAGTCTCCGCTATTTGTTAACTTTGTCCTAATAATTCTGGT
ACTTTAAATCCTATAACTGAGTAAGGAGATGAAACTTAATGTTCTATTTGCACAGATGGT
TATTACATGACTTAAGCATTTTAAATAGGAAAAACTGCATCATGCTAAAAATGTCCTCCT
GGATCTACTTCAAAATAAGGCATTAATACTGGTTGCTATTGCTTTGACTAGAATGCAACA
TGGTCATCAAATACAAATTCCTGCTAATGTAATCAAGGTTATTTTGGTACCCCAGCAACC
TCAATAGGTGCTTAAGGATGCACTCCTTGTCCTGCAGGTTAATACTATTAATCAGGAAAT
TGCGTTGATTGCCAAGCAGGATACTACTCAAGTTCACCTGCAAGTCTTTCATGTACCCTA
TGTACTACTGGTAAATATGCATAAGGAACAGGAAATACATCTTGTGCTAGTTGTCCAGAT
AAATCTACTTCTTCTTTAGATTTTTCTAGCTGTTTGTGTTTTGATTCAAGTGCTATATTT
AAAAACAATATTTGTGTCTGTCCTGATGGTTATTTTGGAACACCAAATTCATCAAGCTAA
CCTGGATGTTCGCCTTGCAGTAAAGGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGT
ACTGTTTGTCCAGCTGGATATTTTGCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGC
AGTGATGGTTAATTCGCTTCTGGTACAGGAAATTCTTCATGTTAAACTTGTGGTTCAAGT
AAAACAAATAATAGTGATTTTACTGATTGCTAATGCATTGATCCTAACTCTAACTTAAAT
GGAGGTAGCTGTATTTGCAATCCAGGCTATATAGGAACACCAGCAACATCAATAGGTGCT
TAAGGATGCACTCCTTGTCCTGCAGGTAAATACTATTAATCAGGAAATTGTGTTGATTGT
CAAGCAGGATACTACTCAAGTTCACCTGCAAGTCTTTCATGTACTCAATGTACTGCTGGT
AATTATGCATAAGGAACAGGAAATACTTCTTGTGCTAGTTGTCCAAATAAAACTACATCT
TCTGTAGATTTTTCTGGCTGCTAGTGTATAGATTCAAGTGCTATATTTAAAAACAATATT
TGTGTCTGTCCTGATGGTTATTTTGGAACACCAAATTCATCAAGCTAACCAGGATGTTCG
CCTTGCAGTAAAGGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGTACTGTTTGTCCA
GCTGGATATTTTGCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGCAGTCATGGTTAA
TTCGCTTCTGGTACAGGAAATTCTTCATGTTAAACTTGTGGTTCAGGTAAAACAAATAAT
AGTGATTTTACTGATTGCTAATGCATTGATCCTAACTCTAAATTAAATGGAGGTAGCTGT
ATTTGCATTCCAGGCTATATAGGAACACCAGCAACATCAATAGGTGCTTAAGGATGCACT
CCTTGTCCTGCAGGTAAATACTATTAATCAGGAAGTTGTGTTGATTGTCAAGCAGGATAC
TACTCAAGTTCACCTGCAAGTCTTTCATGTACCCAATGTATTACTGGTAAATATGCATAA
GGAACAGGAAATACTTCTTGTGCTAGTTGTCCAAATAAAACTACTTCTTCTGTAGATTTT
TCTGGCTGCTAGTGTATAGATTCAAGTGCTATATTTAAAAACAATATTTGTGTCTGTCCT
GATGGTTATTTTGGAACACCAAATTCATCAAGCTAACCTGGATGTTCGCCTTGCAGTAAA
GGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGTACTGTTTGTCCAGCTGGATATTTT
GCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGCAGTCATGGTTAATTCGCTTCTGGT
ACAGGAAATTCTTCATGTTAAACTTGTGGTTCAGGTAAAACAAATAATAGTGATTTTACT
GATTGCTAATGCATTGATCCTAACTCTAAATTAAATGGAGGTAGCTGTATTTGCAATTCA
GGATATATAGGAACACCAGCAACATCAATAAGTGCTTAAGGATGCACTCCTTGTCCTGCA
GGTAAATACTATTAATCAGGAAATTGTGTTGATTGTCAAGCAGGACACTACTCAAGTTCA
CCTGCAAGTCTTTCATGTACCCAATGTACTACTGGTAAATATGCATAAGGCACAGGAAAT
ACTTCTTGCACTAGTTGTCCAAATAATACAACTCCTTTAGCAGATTTTTCTGGATGCTAA
TGTATAGATTCAAGCGCTATATTTAAAAACAATAATTGTGTCTGTCCTGATGGTTATTTT
GGTACACCAAATTCATCAAGCTAACCTGGATGTTCACCTTGCAGTAAAGGTCAGTATTCA
AATTCTTCTACTTCTGGAGCATGTACTGCTTGTCCAGCTGGATATTTTACGGCTAGTATT
GGAAGTTCTTAATGTTAATAATGCAGTGATGGTTAATTCGCTTCTGGTACAGGAAATTCT
TCATGTTAAACTTGTGGTTCAAGTAAAACAAATAATAATGATTTTACTGATTGCTAATGC
ATTGATCATAACTCTAAATTAAATGGAGGTAGCTGTATTTGCAATCCAGGCTATATCGGC
ACACCAGCTACCTCAAAGAATTCTTCAAATAGTTGCACAGCTTGTCCAGCTGGATAATTT
ACAGATTTATCATCTGGAAAATGCTCTCCATGTCCTGCTGGAACATTCTCAAATGGTTAA
GCTAATGTAAATTGCACTTAGTGTAGCTCAGGATAATATGCAAATGGTACTGGAAATACT
TCTTGTAGCAACTGTGGCCCTGGATCTACTAACACAGATGATTTTTCTGGCTGTAAATGT
TATGATTCAAATGCAGTGGTTTGGTCTGCAGATAAAAATTAATGCTAATGTGCTGCTAAT
TTTTATGGAGATGCAAGTTTAGCCACGAGTGTTTCTAAAACTTAATGTATAAACTGTCCA
AACAATACAACATCAAAAATTGGAGCAGCTAAAACTCAAAAAGATTGTTAAAATATTTCT
TCTTCTACTTCTACTTCCTCCTCTTAGAGCTAATAAATTGGTTAATACTCATTTTCTTAA
ATTATAAAAATATCAATAATATTAGCTCTAGTATTGCTGATATGA


>TTHERM_00835390(protein)
MRKINICLVLFVLFQVSFQYCHYSIQNNNGQCNCFGGFYANSANCLVCPNNGLSLGGSIS
ISDCKYCNSNSYYLDQAATDSQGSVCLLCPNNSQTQTNYPQGPQDISDCNICQPGYYLQT
PAVPPQNGNPGQAAVCVPCPNNTTSKMGPNPTSISQCDSCQNGFYISQQATDSQPAICSP
CPINTTNSYDEPSNFQYNINDCTSCMPGYYNSNQNFNQPPMCVQCPPNTFNYITGSFSIS
TCTCMENSYMTVQSTNNSAPTCLPCPNGSGNYQPPLLAGDQSQCDICQAGYYASTPYADP
TNGNPGIASQCHQCPNNSYSDPGLSFYESSCYKCKLNYYMKTAPALGVSAICQLCPNNSG
TLNPITEQGDETQCSICTDGYYMTQAFQIGKTASCQKCPPGSTSKQGINTGCYCFDQNAT
WSSNTNSCQCNQGYFGTPATSIGAQGCTPCPAGQYYQSGNCVDCQAGYYSSSPASLSCTL
CTTGKYAQGTGNTSCASCPDKSTSSLDFSSCLCFDSSAIFKNNICVCPDGYFGTPNSSSQ
PGCSPCSKGQYSNSSTSGACTVCPAGYFAASIGSSQCQQCSDGQFASGTGNSSCQTCGSS
KTNNSDFTDCQCIDPNSNLNGGSCICNPGYIGTPATSIGAQGCTPCPAGKYYQSGNCVDC
QAGYYSSSPASLSCTQCTAGNYAQGTGNTSCASCPNKTTSSVDFSGCQCIDSSAIFKNNI
CVCPDGYFGTPNSSSQPGCSPCSKGQYSNSSTSGACTVCPAGYFAASIGSSQCQQCSHGQ
FASGTGNSSCQTCGSGKTNNSDFTDCQCIDPNSKLNGGSCICIPGYIGTPATSIGAQGCT
PCPAGKYYQSGSCVDCQAGYYSSSPASLSCTQCITGKYAQGTGNTSCASCPNKTTSSVDF
SGCQCIDSSAIFKNNICVCPDGYFGTPNSSSQPGCSPCSKGQYSNSSTSGACTVCPAGYF
AASIGSSQCQQCSHGQFASGTGNSSCQTCGSGKTNNSDFTDCQCIDPNSKLNGGSCICNS
GYIGTPATSISAQGCTPCPAGKYYQSGNCVDCQAGHYSSSPASLSCTQCTTGKYAQGTGN
TSCTSCPNNTTPLADFSGCQCIDSSAIFKNNNCVCPDGYFGTPNSSSQPGCSPCSKGQYS
NSSTSGACTACPAGYFTASIGSSQCQQCSDGQFASGTGNSSCQTCGSSKTNNNDFTDCQC
IDHNSKLNGGSCICNPGYIGTPATSKNSSNSCTACPAGQFTDLSSGKCSPCPAGTFSNGQ
ANVNCTQCSSGQYANGTGNTSCSNCGPGSTNTDDFSGCKCYDSNAVVWSADKNQCQCAAN
FYGDASLATSVSKTQCINCPNNTTSKIGAAKTQKDCQNISSSTSTSSSQSQQIGQYSFSQ
IIKISIILALVLLI


>TTHERM_00835390(gene)
ATGAGAAAAATAAACATTTGCCTCGTTCTTTTTGTGCTATTCTAGGTCTCCTTTTAGTAC
TGTCACTATTCAATTTAAAATAATAATGGTTAATGCAATTGCTTTGGTGGATTTTATGCT
AACTCTGCTAATTGTTTAGTATGCCCAAATAATGGATTAAGTTTAGGAGGATCTATTTCA
ATATCAGATTGCAAATATTGTAACTCTAATTCATACTATTTGGATTAGGCAGCAACAGAT
TCTTAAGGTTCAGTGTGCTTATTATGCCCTAATAACTCCTAGACTCAAACTAATTATCCT
TAGGGACCTCAAGATATTAGTGATTGTAATATTTGCTAACCTGGTTATTATCTTTAGACC
CCAGCAGTTCCACCTTAAAATGGTAATCCTGGCTAAGCTGCAGTTTGCGTTCCGTGCCCA
AATAATACAACAAGTAAAATGGGTCCAAATCCTACTTCAATCTCTTAATGTGATTCATGC
TAAAATGGGTTTTATATTTCTTAGCAAGCAACAGATTCCCAACCAGCAATTTGTTCACCT
TGTCCTATTAATACGACAAATAGCTACGATGAACCTTCTAATTTTTAATATAATATTAAT
GATTGCACTTCATGTATGCCTGGCTATTATAATTCTAATCAAAACTTTAATTAACCACCT
ATGTGTGTATAATGTCCTCCAAATACATTTAATTACATTACAGGTTCTTTTTCAATTTCA
ACTTGTACTTGTATGGAAAACTCCTATATGACAGTTCAGTCAACAAATAATTCTGCTCCA
ACTTGTTTGCCATGTCCTAATGGTTCAGGAAACTATTAACCACCTTTATTAGCTGGAGAT
TAATCTCAATGCGACATTTGCTAAGCGGGTTACTACGCATCCACGCCATATGCAGATCCT
ACAAATGGAAATCCAGGAATTGCATCCTAGTGCCACCAATGTCCAAATAATTCTTATTCT
GACCCCGGACTTTCATTTTATGAATCAAGTTGTTATAAGTGCAAACTTAATTATTACATG
AAAACCGCTCCCGCACTAGGAGTCTCCGCTATTTGTTAACTTTGTCCTAATAATTCTGGT
ACTTTAAATCCTATAACTGAGTAAGGAGATGAAACTTAATGTTCTATTTGCACAGATGGT
TATTACATGACTTAAGCATTTTAAATAGGAAAAACTGCATCATGCTAAAAATGTCCTCCT
GGATCTACTTCAAAATAAGGCATTAATACTGGTTGCTATTGCTTTGACTAGAATGCAACA
TGGTCATCAAATACAAATTCCTGCTAATGTAATCAAGGTTATTTTGGTACCCCAGCAACC
TCAATAGGTGCTTAAGGATGCACTCCTTGTCCTGCAGGTTAATACTATTAATCAGGAAAT
TGCGTTGATTGCCAAGCAGGATACTACTCAAGTTCACCTGCAAGTCTTTCATGTACCCTA
TGTACTACTGGTAAATATGCATAAGGAACAGGAAATACATCTTGTGCTAGTTGTCCAGAT
AAATCTACTTCTTCTTTAGATTTTTCTAGCTGTTTGTGTTTTGATTCAAGTGCTATATTT
AAAAACAATATTTGTGTCTGTCCTGATGGTTATTTTGGAACACCAAATTCATCAAGCTAA
CCTGGATGTTCGCCTTGCAGTAAAGGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGT
ACTGTTTGTCCAGCTGGATATTTTGCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGC
AGTGATGGTTAATTCGCTTCTGGTACAGGAAATTCTTCATGTTAAACTTGTGGTTCAAGT
AAAACAAATAATAGTGATTTTACTGATTGCTAATGCATTGATCCTAACTCTAACTTAAAT
GGAGGTAGCTGTATTTGCAATCCAGGCTATATAGGAACACCAGCAACATCAATAGGTGCT
TAAGGATGCACTCCTTGTCCTGCAGGTAAATACTATTAATCAGGAAATTGTGTTGATTGT
CAAGCAGGATACTACTCAAGTTCACCTGCAAGTCTTTCATGTACTCAATGTACTGCTGGT
AATTATGCATAAGGAACAGGAAATACTTCTTGTGCTAGTTGTCCAAATAAAACTACATCT
TCTGTAGATTTTTCTGGCTGCTAGTGTATAGATTCAAGTGCTATATTTAAAAACAATATT
TGTGTCTGTCCTGATGGTTATTTTGGAACACCAAATTCATCAAGCTAACCAGGATGTTCG
CCTTGCAGTAAAGGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGTACTGTTTGTCCA
GCTGGATATTTTGCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGCAGTCATGGTTAA
TTCGCTTCTGGTACAGGAAATTCTTCATGTTAAACTTGTGGTTCAGGTAAAACAAATAAT
AGTGATTTTACTGATTGCTAATGCATTGATCCTAACTCTAAATTAAATGGAGGTAGCTGT
ATTTGCATTCCAGGCTATATAGGAACACCAGCAACATCAATAGGTGCTTAAGGATGCACT
CCTTGTCCTGCAGGTAAATACTATTAATCAGGAAGTTGTGTTGATTGTCAAGCAGGATAC
TACTCAAGTTCACCTGCAAGTCTTTCATGTACCCAATGTATTACTGGTAAATATGCATAA
GGAACAGGAAATACTTCTTGTGCTAGTTGTCCAAATAAAACTACTTCTTCTGTAGATTTT
TCTGGCTGCTAGTGTATAGATTCAAGTGCTATATTTAAAAACAATATTTGTGTCTGTCCT
GATGGTTATTTTGGAACACCAAATTCATCAAGCTAACCTGGATGTTCGCCTTGCAGTAAA
GGTCAGTATTCAAATTCTTCTACTTCTGGAGCATGTACTGTTTGTCCAGCTGGATATTTT
GCAGCTAGTATTGGAAGTTCTTAATGTTAATAATGCAGTCATGGTTAATTCGCTTCTGGT
ACAGGAAATTCTTCATGTTAAACTTGTGGTTCAGGTAAAACAAATAATAGTGATTTTACT
GATTGCTAATGCATTGATCCTAACTCTAAATTAAATGGAGGTAGCTGTATTTGCAATTCA
GGATATATAGGAACACCAGCAACATCAATAAGTGCTTAAGGATGCACTCCTTGTCCTGCA
GGTAAATACTATTAATCAGGAAATTGTGTTGATTGTCAAGCAGGACACTACTCAAGTTCA
CCTGCAAGTCTTTCATGTACCCAATGTACTACTGGTAAATATGCATAAGGCACAGGAAAT
ACTTCTTGCACTAGTTGTCCAAATAATACAACTCCTTTAGCAGATTTTTCTGGATGCTAA
TGTATAGATTCAAGCGCTATATTTAAAAACAATAATTGTGTCTGTCCTGATGGTTATTTT
GGTACACCAAATTCATCAAGCTAACCTGGATGTTCACCTTGCAGTAAAGGTCAGTATTCA
AATTCTTCTACTTCTGGAGCATGTACTGCTTGTCCAGCTGGATATTTTACGGCTAGTATT
GGAAGTTCTTAATGTTAATAATGCAGTGATGGTTAATTCGCTTCTGGTACAGGAAATTCT
TCATGTTAAACTTGTGGTTCAAGTAAAACAAATAATAATGATTTTACTGATTGCTAATGC
ATTGATCATAACTCTAAATTAAATGGAGGTAGCTGTATTTGCAATCCAGGCTATATCGGC
ACACCAGCTACCTCAAAGAATTCTTCAAATAGTTGCACAGCTTGTCCAGCTGGATAATTT
ACAGATTTATCATCTGGAAAATGCTCTCCATGTCCTGCTGGAACATTCTCAAATGGTTAA
GCTAATGTAAATTGCACTTAGTGTAGCTCAGGATAATATGCAAATGGTACTGGAAATACT
TCTTGTAGCAACTGTGGCCCTGGATCTACTAACACAGATGATTTTTCTGGCTGTAAATGT
TATGATTCAAATGCAGTGGTTTGGTCTGCAGATAAAAATTAATGCTAATGTGCTGCTAAT
TTTTATGGAGATGCAAGTTTAGCCACGAGTGTTTCTAAAACTTAATGTATAAACTGTCCA
AACAATACAACATCAAAAATTGGAGCAGCTAAAACTCAAAAAGATTGTTAAAATATTTCT
TCTTCTACTTCTACTTCCTCCTCTTAGAGCTAATAAATTGGTTAATACTCATTTTCTTAA
ATTATAAAAATATCAATAATATTAGCTCTAGTATTGCTGATATGA