Identifiers and Description

Gene Model Identifier

TTHERM_00825530

Standard Name

None

Aliases

PreTt04017 | 142.m00114 | 3683.m00047

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01637 ) Archaeal ATPase
  • ( PF00004 ) ATPase, AAA family
  • ( PF04878 ) Baculovirus P48 protein
  • ( PF06292 ) Domain of Unknown Function (DUF1041)
  • ( TIGR00073 ) hydrogenase accessory protein HypB

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00825530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18265.19.997093137033517e-262hypothetical protein (469 aa)
OxytrichaContig20743.0.g340.0000004998288985444982AAA domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825530(coding)
ATGAGTGGGTTATCTGATGACTTTTAAAAGTCCTGCGTTCAGAGATAACCATAAGTGTCT
TTGATATCAAATTTACTAGATAGTGATAGTGATATGATTATTTATGGTATTTCAGGATCT
GGAAAAACTACTCTTATTCGTGATTTACTTTAAGAAAAGTAGATCAATTATGTAAAAATA
AATTGTATTTAATGCTAAACTAAGAAAACTGTAATTTAAGCATTAATATCTTCTTTAGAA
GCTAAATTTAATTATAAGTTAAAACAAACTACAAAAACAAGCTAATTAATTCATAGAATA
AACCAGCTTCATGAATTCACTAAATAATAAGAGCTAGATGAGAATTCATAACAGTATTTT
TCTTTTGAAGATCATCATTTCTACTTATGGCTGGATAATATTGAAAAGTTGTCAATAACA
CCTAAATTCTTTTCATAATTAATCAGTATAAAAAACATTTTAAAGATAAATTTTTGTATT
ATATTTTCTGGAATTACTTTCTAAGATCAAGCAATCCTCGAAAATAGCGAAATAGATTTA
CTGCCTGCTATTACTCTATAGCCAATCGACATTAAAAATTTGAAGAATGTAATTAAAATA
AACCTACAAAATAAGCTTTTAGACTAAGAAAAAAAATGTTTTGAAGTCTTTGGTGATAAA
TTTATTAATGATATGGTATAAAACTTTAATATTATTATAAAAAACGCTACAACAATGTGC
AGTATCTGCCTTAAACTTTTCAAATTTCTTATCAATAGTTATGATAGAAAAGAAAATCCT
TAGATAAAAGATTTTGTTCACCTTATTAAAGAAGATAATTTCGTGTATGCTAGAAAACTA
ATACTTTAAGATCCATACCTAAATGAAGGAGATACCAAAGAATTCATAGAAAAAATAACC
AATAATAAATCTATTAGGTCTGAGTCATTTTCATTAATCAGCCCTATCTAAATAGCCAAA
CTACCATTTTACTCCTCTATGATTCTATTAGCGTGCTGGATTGGAAATAGAAATCCTGAA
AGTACTGATAAAAAGCTTTTTAAAGATTATAAAGGTAGATAGTATAAAGGAAAGTAAGAA
GGTACATTATAGTTTTTAAAACCTATAAAAATTGACCGTATGATAGCTTTAGCTTAATGT
CTTATCAGTTAAAGTGAGTTTATAAAGAACTATAGCTTGAATAGATAGAGTGAATTGAAT
TTGTATGATTAGTCAGTTGACTTTTATTCTTAAATAGCATCATTAATAGAAATGAAATAT
ATTACATTAGATTCAAGCGAAGCTTCTTTAGCTAAAGCTTAATACATATCTACTTTAGAC
GAATAATTTATTTTATCAATAGCTCATTAAAACAAAATTAAACTCTATGACTTCCTTTAC
AAGAAAGAATGA


>TTHERM_00825530(protein)
MSGLSDDFQKSCVQRQPQVSLISNLLDSDSDMIIYGISGSGKTTLIRDLLQEKQINYVKI
NCIQCQTKKTVIQALISSLEAKFNYKLKQTTKTSQLIHRINQLHEFTKQQELDENSQQYF
SFEDHHFYLWLDNIEKLSITPKFFSQLISIKNILKINFCIIFSGITFQDQAILENSEIDL
LPAITLQPIDIKNLKNVIKINLQNKLLDQEKKCFEVFGDKFINDMVQNFNIIIKNATTMC
SICLKLFKFLINSYDRKENPQIKDFVHLIKEDNFVYARKLILQDPYLNEGDTKEFIEKIT
NNKSIRSESFSLISPIQIAKLPFYSSMILLACWIGNRNPESTDKKLFKDYKGRQYKGKQE
GTLQFLKPIKIDRMIALAQCLISQSEFIKNYSLNRQSELNLYDQSVDFYSQIASLIEMKY
ITLDSSEASLAKAQYISTLDEQFILSIAHQNKIKLYDFLYKKE


>TTHERM_00825530(gene)
ATGAGTGGGTTATCTGATGACTTTTAAAAGTCCTGCGTTCAGAGATAACCATAAGTGTCT
TTGATATCAAATTTACTAGATAGTGATAGTGATATGATTATTTATGGTATTTCAGGATCT
GGAAAAACTACTCTTATTCGTGATTTACTTTAAGAAAAGTAGATCAATTATGTAAAAATA
AATTGTATTTAATGCTAAACTAAGAAAACTGTAATTTAAGCATTAATATCTTCTTTAGAA
GCTAAATTTAATTATAAGTTAAAACAAACTACAAAAACAAGCTAATTAATTCATAGAATA
AACCAGCTTCATGAATTCACTAAATAATAAGAGCTAGATGAGAATTCATAACAGTATTTT
TCTTTTGAAGATCATCATTTCTACTTATGGCTGGATAATATTGAAAAGTTGTCAATAACA
CCTAAATTCTTTTCATAATTAATCAGTATAAAAAACATTTTAAAGATAAATTTTTGTATT
ATATTTTCTGGAATTACTTTCTAAGATCAAGCAATCCTCGAAAATAGCGAAATAGATTTA
CTGCCTGCTATTACTCTATAGCCAATCGACATTAAAAATTTGAAGAATGTAATTAAAATA
AACCTACAAAATAAGCTTTTAGACTAAGAAAAAAAATGTTTTGAAGTCTTTGGTGATAAA
TTTATTAATGATATGGTATAAAACTTTAATATTATTATAAAAAACGCTACAACAATGTGC
AGTATCTGCCTTAAACTTTTCAAATTTCTTATCAATAGTTATGATAGAAAAGAAAATCCT
TAGATAAAAGATTTTGTTCACCTTATTAAAGAAGATAATTTCGTGTATGCTAGAAAACTA
ATACTTTAAGATCCATACCTAAATGAAGGAGATACCAAAGAATTCATAGAAAAAATAACC
AATAATAAATCTATTAGGTCTGAGTCATTTTCATTAATCAGGTAATCCATTTTATATTTT
TATTTATTTTATTCTTAATATAAAATTATCTATTTATTATAAAGCCCTATCTAAATAGCC
AAACTACCATTTTACTCCTCTATGATTCTATTAGCGTGCTGGATTGGAAATAGAAATCCT
GAAAGTACTGATAAAAAGCTTTTTAAAGATTATAAAGGTAGATAGTATAAAGGAAAGTAA
GAAGGTACATTATAGTTTTTAAAACCTATAAAAATTGACCGTATGATAGCTTTAGCTTAA
TGTCTTATCAGTTAAAGTGAGTTTATAAAGAACTATAGCTTGAATAGATAGAGTGAATTG
AATTTGTATGATTAGTCAGTTGACTTTTATTCTTAAATAGCATCATTAATAGAAATGAAA
TATATTACATTAGATTCAAGCGAAGCTTCTTTAGCTAAAGCTTAATACATATCTACTTTA
GACGAATAATTTATTTTATCAATAGCTCATTAAAACAAAATTAAACTCTATGACTTCCTT
TACAAGAAAGAATGA