Identifiers and Description

Gene Model Identifier

TTHERM_00809240

Standard Name

None

Aliases

PreTt23419 | 137.m00113

Description

type A von willebrand factor domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08487 ) Vault protein inter-alpha-trypsin
  • ( PF00092 ) von Willebrand factor type A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00809240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18585.19.997093137033517e-262glutathionylspermidine synthas
e (894 aa)
OxytrichaContig10874.0.g319.000270655364168e-50von Willebrand factor type A d
omain
DictyBaseDDB_G02920281.9991939848149086e-44DDB_G0292028 on chromosome: 6
position 1046109 to 1048990
Stentor CoeruleusSteCoe_265191.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00809240(coding)
ATGAAATAGAATAAGCAATTTTCACTACATACTTTAGAATATTGTAAATCTGTTTAGAAT
AAATATTAATCAGCTTAAACACCTGCTACACTTAAGAGCGTTCAATATAAATGTTAGATT
ATCAATAACATACTAAAAACTACCTTAACTTAAACTTTTGTTAGCTATTCTTCAAGCGAG
AATTCTGAAACTATTTACTATTTCCCAATAATTAATGGTACTTGCTTAGAATTGTTTGAA
GCTAAATACAATGATAAAACAATAAAAGGAATTATTAAGGAGAAATCTGTGGCTAAAAAA
GAATATCAAGAAAATAAAAACCAAGGGAACTTTGTTTCCTATGCTAAAACTTCTACTGAA
GACGATTAACTATTTTGTGAAATTCTTTTAGGAAATTTACCTCCTAATTAATAAGTTGAA
ATTCATCTGATATTTTCTTAGTAGCTCTCGAGCATATTAAATAAATACTTTGTTGCTACA
ATTCCACTTTAATATTGCGAAGATAATATTTCAGCTAAATTAGGAATAAATTTACTAACA
TTAGACTTATTCTGCACTGGAAAAATTACTTATGCTGAATCTAGAGGATAGAAAACTGAG
AAAGTTATAGTTGATGATAATACAGTCAAGTTTAATCTATCTCAAGCCCTTAACCAAAAA
GGAAACGAACTTTAATTTGTTTTCTCTTTTGAAGGTATGTTTGAACCTTAAATTATTTTT
GGATCAAGTAGAATTTTCCATGAAGACTATGTAAAAAGAGCAATTCTTCCTGTGAGCAAT
TCTGTAATGGTTTCATTTATTCCTAATTTTAATGAAGAAATAACCAAAGAAGTAGATGAT
GCAGTTAAAGCAGCTCTAAATAAAGGAGAAGATGTCATTTGCGAAGAATTCTAGTAAAAA
ATATCCTCAGAGTTAGTAGATCATTTGAATTCCTCAAAAAGTGAATTTATTTTCTTATTA
GATAGGAGCGGATCTATGAGTGGATAGTCTATTAAGCAAGCATGTGAGGCTCTTGTTTTA
TTCTTATAGAGTCTTCCAATTGACAGTTACTTTAATGTTGTCAGTTTTGGTAGTTCATTC
GAAAAGCTTTTTCCATCCTCATAAAAATATAATAGCTAAAATCTTGAATAAGCTGTTCAA
ATTATTAATCAATATTCAGCTAATTTAGGTGGTACAGAAATTTATTAACCTTTACATAAT
GTTTTTAATGAAAAAAAAATTGAAGGATACAACAAATAAATATTTTTATTGACAGATGGC
CAGGTTGATAATCCAAAATAAGTTGTAAATTTGATAAAAAAAAATAATAAATTTAGCAGA
ATCCACTCTATTGGTTTTGGAAATGATGCAGATAAATAATTAATTTAAGAAACTGCTGTC
TATGGTAAAGGTATTTCTAAGATTGTAAATTAGAATTGTGATTTGCAAGAAGTTGTTATA
GAAATGCTTTCTCTTAGCATAACTCCTACACTTGATCAATTTAAAATGATTTATGATTAA
AATATTTTTGAATCTACTTATCCCTCAAGCACTAATTTCCCTTGTATTTTTAAAGATGAA
ATTATAAATATTCATCTCTTTTTCAAGCCTCTAGTATAGATTTCAGAGCTAACTTAGGAA
TAAAAATAAATAGAAATAGAGTATTACGATTCCTGCCAAAAGCAAAAAGTATAAAAGAAA
CTAATAATGTAAATGTAGGACAGTTTTTCTTGCAATTCTGAACTTCAGTAATCTGTTTTT
AAAATAGGAAAATAATTATAATTAAATGAAATGATAGAGGAATAGGAATAAGAATATAAT
GATAAAATACTATAGCAATCAATCGATTATTAGCTTCTTACATAAAATACAGCTTTAATT
TGTGTTATTGAGACCTTAAATGATGAATAGAAAGTTATATTTGAAAATCTAAAACATAGC
CCATTTCATTAATAGCTTAATTAGATTTAATCAATTGAAAAAGAATCAATGCAAATTCAA
TAAAATATTGCTTATAATTATTAATCTTCAAGCTATGCAGCCGCAGCTACCCCAGCCTAG
AAATCTTAATATAAATTAGAAGTAGAGGAAGATGATTTTGAAGGAGATGATTTATTTGGA
TGCGATTTTGGTATTGTAGGCTCTTATAGTTCTTCAAACTATTCAATTAATCAATCGAGT
TAGCAACAGTAAGTTTTAGAAAATGAAAGTAATTTTAGTTAAATAAAAAACCAAAGTAAT
TAAAATATCTAAGATTTAATAAAAAATTCTAAACCTAACTTGCAAAATTTACTTAATTTA
GTTGATTCAGAGGGAGTATGGAAGTATGATGATATTTTAATCAAATAGTGTTGTAGTAAA
ATTGACTCAGCTTAAATCAAAAAATACTGCTCCAATTTTATTACTCAAAATGCATTTATG
ACTCTACTAGTTATAATTTTCTTAGAGATAGAATACAGCTAATAAAAGAATAAATGGAAA
CTAATATCAAAAAAATCCAATAACTTCATTTAATCATAAATCAAAGCAGGAATTGATTTG
AATTCTTTAAAAGAAACAATTAAAAAATTAATTATCAGTTGA


>TTHERM_00809240(protein)
MKQNKQFSLHTLEYCKSVQNKYQSAQTPATLKSVQYKCQIINNILKTTLTQTFVSYSSSE
NSETIYYFPIINGTCLELFEAKYNDKTIKGIIKEKSVAKKEYQENKNQGNFVSYAKTSTE
DDQLFCEILLGNLPPNQQVEIHLIFSQQLSSILNKYFVATIPLQYCEDNISAKLGINLLT
LDLFCTGKITYAESRGQKTEKVIVDDNTVKFNLSQALNQKGNELQFVFSFEGMFEPQIIF
GSSRIFHEDYVKRAILPVSNSVMVSFIPNFNEEITKEVDDAVKAALNKGEDVICEEFQQK
ISSELVDHLNSSKSEFIFLLDRSGSMSGQSIKQACEALVLFLQSLPIDSYFNVVSFGSSF
EKLFPSSQKYNSQNLEQAVQIINQYSANLGGTEIYQPLHNVFNEKKIEGYNKQIFLLTDG
QVDNPKQVVNLIKKNNKFSRIHSIGFGNDADKQLIQETAVYGKGISKIVNQNCDLQEVVI
EMLSLSITPTLDQFKMIYDQNIFESTYPSSTNFPCIFKDEIINIHLFFKPLVQISELTQE
QKQIEIEYYDSCQKQKVQKKLIMQMQDSFSCNSELQQSVFKIGKQLQLNEMIEEQEQEYN
DKILQQSIDYQLLTQNTALICVIETLNDEQKVIFENLKHSPFHQQLNQIQSIEKESMQIQ
QNIAYNYQSSSYAAAATPAQKSQYKLEVEEDDFEGDDLFGCDFGIVGSYSSSNYSINQSS
QQQQVLENESNFSQIKNQSNQNIQDLIKNSKPNLQNLLNLVDSEGVWKYDDILIKQCCSK
IDSAQIKKYCSNFITQNAFMTLLVIIFLEIEYSQQKNKWKLISKKSNNFIQSQIKAGIDL
NSLKETIKKLIIS


>TTHERM_00809240(gene)
ATGAAATAGAATAAGCAATTTTCACTACATACTTTAGAATATTGTAAATCTGTTTAGAAT
AAATATTAATCAGCTTAAACACCTGCTACACTTAAGAGCGTTCAATATAAATGTTAGATT
ATCAATAACATACTAAAAACTACCTTAACTTAAACTTTTGTTAGCTATTCTTCAAGCGAG
AATTCTGAAACTATTTACTATTTCCCAATAATTAATGGTACTTGCTTAGAATTGTTTGAA
GCTAAATACAATGATAAAACAATAAAAGGAATTATTAAGGAGAAATCTGTGGCTAAAAAA
GAATATCAAGAAAATAAAAACCAAGGGAACTTTGTTTCCTATGCTAAAACTTCTACTGAA
GACGATTAACTATTTTGTGAAATTCTTTTAGGAAATTTACCTCCTAATTAATAAGTTGAA
ATTCATCTGATATTTTCTTAGTAGCTCTCGAGCATATTAAATAAATACTTTGTTGCTACA
ATTCCACTTTAATATTGCGAAGATAATATTTCAGCTAAATTAGGAATAAATTTACTAACA
TTAGACTTATTCTGCACTGGAAAAATTACTTATGCTGAATCTAGAGGATAGAAAACTGAG
AAAGTTATAGTTGATGATAATACAGTCAAGTTTAATCTATCTCAAGCCCTTAACCAAAAA
GGAAACGAACTTTAATTTGTTTTCTCTTTTGAAGGTATGTTTGAACCTTAAATTATTTTT
GGATCAAGTAGAATTTTCCATGAAGACTATGTAAAAAGAGCAATTCTTCCTGTGAGCAAT
TCTGTAATGGTTTCATTTATTCCTAATTTTAATGAAGAAATAACCAAAGAAGTAGATGAT
GCAGTTAAAGCAGCTCTAAATAAAGGAGAAGATGTCATTTGCGAAGAATTCTAGTAAAAA
ATATCCTCAGAGTTAGTAGATCATTTGAATTCCTCAAAAAGTGAATTTATTTTCTTATTA
GATAGGAGCGGATCTATGAGTGGATAGTCTATTAAGCAAGCATGTGAGGCTCTTGTTTTA
TTCTTATAGAGTCTTCCAATTGACAGTTACTTTAATGTTGTCAGTTTTGGTAGTTCATTC
GAAAAGCTTTTTCCATCCTCATAAAAATATAATAGCTAAAATCTTGAATAAGCTGTTCAA
ATTATTAATCAATATTCAGCTAATTTAGGTGGTACAGAAATTTATTAACCTTTACATAAT
GTTTTTAATGAAAAAAAAATTGAAGGATACAACAAATAAATATTTTTATTGACAGATGGC
CAGGTTGATAATCCAAAATAAGTTGTAAATTTGATAAAAAAAAATAATAAATTTAGCAGA
ATCCACTCTATTGGTTTTGGAAATGATGCAGATAAATAATTAATTTAAGAAACTGCTGTC
TATGGTAAAGGTATTTCTAAGATTGTAAATTAGAATTGTGATTTGCAAGAAGTTGTTATA
GAAATGCTTTCTCTTAGCATAACTCCTACACTTGATCAATTTAAAATGATTTATGATTAA
AATATTTTTGAATCTACTTATCCCTCAAGCACTAATTTCCCTTGTATTTTTAAAGATGAA
ATTATAAATATTCATCTCTTTTTCAAGCCTCTAGTATAGATTTCAGAGCTAACTTAGGAA
TAAAAATAAATAGAAATAGAGTATTACGATTCCTGCCAAAAGCAAAAAGTATAAAAGAAA
CTAATAATGTAAATGTAGGACAGTTTTTCTTGCAATTCTGAACTTCAGTAATCTGTTTTT
AAAATAGGAAAATAATTATAATTAAATGAAATGATAGAGGAATAGGAATAAGAATATAAT
GATAAAATACTATAGCAATCAATCGATTATTAGCTTCTTACATAAAATACAGCTTTAATT
TGTGTTATTGAGACCTTAAATGATGAATAGAAAGTTATATTTGAAAATCTAAAACATAGC
CCATTTCATTAATAGCTTAATTAGATTTAATCAATTGAAAAAGAATCAATGCAAATTCAA
TAAAATATTGCTTATAATTATTAATCTTCAAGCTATGCAGCCGCAGCTACCCCAGCCTAG
AAATCTTAATATAAATTAGAAGTAGAGGAAGATGATTTTGAAGGAGATGATTTATTTGGA
TGCGATTTTGGTATTGTAGGCTCTTATAGTTCTTCAAACTATTCAATTAATCAATCGAGT
TAGCAACAGTAAGTTTTAGAAAATGAAAGTAATTTTAGTTAAATAAAAAACCAAAGTAAT
TAAAATATCTAAGATTTAATAAAAAATTCTAAACCTAACTTGCAAAATTTACTTAATTTA
GTTGATTCAGAGGGAGTATGGAAGTATGATGATATTTTAATCAAATAGTGTTGTAGTAAA
ATTGACTCAGCTTAAATCAAAAAATACTGCTCCAATTTTATTACTCAAAATGCATTTATG
ACTCTACTAGTTATAATTTTCTTAGAGATAGAATACAGCTAATAAAAGAATAAATGGAAA
CTAATATCAAAAAAATCCAATAACTTCATTTAATCATAAATCAAAGCAGGAATTGATTTG
AATTCTTTAAAAGAAACAATTAAAAAATTAATTATCAGTTGA