Identifiers and Description

Gene Model Identifier

TTHERM_00797980

Standard Name

None

Aliases

PreTt23237 | 135.m00088

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04874 ) Mak16 protein
  • ( PF08241 ) methyltransferase domain
  • ( PF07222 ) Proacrosin binding protein sp32
  • ( PF08704 ) tRNA methyltransferase complex GCD14 subunit
  • ( TIGR02469 ) precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00797980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10543.19.997093137033517e-262hypothetical protein (417 aa)
OxytrichaContig8327.0.g411.9990871925214856e-61tRNA methyltransferase complex
GCD14 subunit
WormBaseWBGene000121922.999661265281073e-47status:Confirmed UniProt:G5E
GR8 protein_id:CAB04894.1
SGDYJL125C5.998439611888618e-47GCD14 Subunit of tRNA (1-methy
ladenosine) methyltransferase,
with Gcd10p, required for the
modification of the adenine a
t position 58 in tRNAs, especi
ally tRNAi-Met; first identifi
ed as a negative regulator of
GCN4 expression
DictyBaseDDB_G02715129.002473480287786e-47trmt61 on chromosome: 2 positi
on 468500 to 469516
Stentor CoeruleusSteCoe_208504.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00797980(coding)
ATGGAAGGAGAGATTTAAGCTTAGAATGCTGAAACCGAGCAATAAGTTAAAAATTAAAAT
GAGCAAAGTTAATAGTCAGCAAATTAAGTTGCAAATGAAGAAGTTAAATAGAGCGATAAC
CAATAGCAACTGCTTTCAAACACAATTAAATATGGAGATTAAGTTGTTTTTTATGAAAGT
GTAAATAGCATGAAAATGTAAACAATCGTTGAAAATGGATTCTTTTAAAACAGATTTGGC
TACTTTGGACATTCTGAAGTAGTAGGAAAGCAATTTGGTCAAAAGATTTTTAACTTGAAG
AAGAATGCTTTTATTTATTTACTTAGACCTGATCCTGTTTTAATCACTGATACTCTATCT
CATTTGACTTAAATTTTATATTAGGCTGATATTTCTTATGTCATTTCTAAGATGAATATT
TAACCAGGTTCAATAGTCGTCGAATCAGGTACTGGTAGTGCTAGTCTCAGTTCATCTATT
GCAAGAACTATCTAAGACGAAGGTCATTTATACACTTTTGAATTCAACGAAGCTAGAGCT
AAAAATGGTGCTGAAGTTTTAGCTGCACAAGGATTGAAAAATTTTGATGTTATCTGGAGA
GATGTTCTATCAAATGGCTTCATGCCTATTCCCGGCGAAAGAGTTTACAATCTTAAAGAA
CACAGTGCTGATGCTGTATTTTTGGATTTGCCTAGACCTTATGAGGCTATTACTCATGCT
AAGCAAGTGCTTAAAAAAGGTGGCAGACTTTGCTGCTTTTCTCCTTGCATTGAATAGGTA
ATGAAGAATTGTGAAGAAATGAGAATCTAGAAATTCGTTTAAATTGTCACTATCGAAGTC
ATTTAAAGACCTTTTGAAAGAAGAGAGAGAACATTTTAGAGTGCCTTCTAAGTTTTGAAC
CCTAATTTTATCAATAACAAAAGAAAGAGAGACGAAGTTGGAGACAATGCTCAAGAGTAA
GAAAATATTTAGGAAGATTAGCAATAATAAATAGCAGCAGAAGATGAAAATGAAAATAAT
GATGAAGAAAACAATCAAGATGATGAACAAGGAGAAGATGAAGAAGAAAGCCAAGAAGAG
GCTGATCAAGCAAATAAAAAAGGAAAGCAAAATAAAAACAATAAGAAAGATAAAAGAAAC
AAATAATAAAACAATTAAAATGGCTCCAAACCTATCCCATAATTTATTAGACCATAAATA
ACTAAAGTAGTATATTCAAGTGGACCCAAAGAAATCAAAGGTCATACTGGATATTTATCT
TTTGGTATTTGTATTTGA


>TTHERM_00797980(protein)
MEGEIQAQNAETEQQVKNQNEQSQQSANQVANEEVKQSDNQQQLLSNTIKYGDQVVFYES
VNSMKMQTIVENGFFQNRFGYFGHSEVVGKQFGQKIFNLKKNAFIYLLRPDPVLITDTLS
HLTQILYQADISYVISKMNIQPGSIVVESGTGSASLSSSIARTIQDEGHLYTFEFNEARA
KNGAEVLAAQGLKNFDVIWRDVLSNGFMPIPGERVYNLKEHSADAVFLDLPRPYEAITHA
KQVLKKGGRLCCFSPCIEQVMKNCEEMRIQKFVQIVTIEVIQRPFERRERTFQSAFQVLN
PNFINNKRKRDEVGDNAQEQENIQEDQQQQIAAEDENENNDEENNQDDEQGEDEEESQEE
ADQANKKGKQNKNNKKDKRNKQQNNQNGSKPIPQFIRPQITKVVYSSGPKEIKGHTGYLS
FGICI


>TTHERM_00797980(gene)
AAAAATAAAAAATTTATTAATATTATTTCAATATCTTTTTTGTGCTAAAAGTCTAATTAA
TTAAATACAGAAAAAGACATATTAATAAAGATGGAAGGAGAGATTTAAGCTTAGAATGCT
GAAACCGAGCAATAAGTTAAAAATTAAAATGAGCAAAGTTAATAGTCAGCAAATTAAGTT
GCAAATGAAGAAGTTAAATAGAGCGATAACCAATAGCAACTGCTTTCAAACACAATTAAA
TATGGAGATTAAGTTGTTTTTTATGAAAGTGTAAATAGCATGAAAATGTAAACAATCGTT
GAAAATGGATTCTTTTAAAACAGATTTGGCTACTTTGGACATTCTGAAGTAGTAGGAAAG
CAATTTGGTCAAAAGGTAAAGAATCAAATTACTTCATACATTAAAACATATTTTAAATAT
GCCTGTTTTTATTTAACAAGAATGTCTAATTTATAATTTATTTATAAATTAATTGCTTTA
TTTTTAATCATAGATTTTTAACTTGAAGAAGAATGCTTTTATTTATTTACTTAGACCTGA
TCCTGTTTTAATCACTGATACTCTATCTCATTTGACTTAAATTTTATATTAGGCTGATAT
TTCTTATGTCATTTCTAAGATGAATATTTAACCAGGTTCAATAGTCGTCGAATCAGGTAG
AAGTTCTTACTAACAATTAGCCAAAACAATTCTAAATAAATATTAATTCAAATATGCCAA
TTTATGTTTAAATTCATTTATTTATTTATTTATTACTAATTAAATAGGTACTGGTAGTGC
TAGTCTCAGTTCATCTATTGCAAGAACTATCTAAGACGAAGGTCATTTATACACTTTTGA
ATTCAACGAAGCTAGAGCTAAAAATGGTGCTGAAGTTTTAGCTGCACAAGGATTGAAAAA
TTTTGATGTTATCTGGAGAGATGTTCTATCAAATGGCTTCATGCCTATTCCCGGCGAAAG
AGTTTACAATCTTAAAGAACACAGTGCTGATGCTGTATTTTTGGATTTGCCTAGACCTTA
TGAGGCTATTACTCATGCTAAGCAAGTGCTTAAAAAAGGTGGCAGACTTTGCTGCTTTTC
TCCTTGCATTGAATAGGTAATGAAGAATTGTGAAGAAATGAGAATCTAGAAATTCGTTTA
AATTGTCACTATCGAAGTCATTTAAAGACCTTTTGAAAGAAGAGAGAGAACATTTTAGAG
TGCCTTCTAAGTTTTGAACCCTAATTTTATCAATAACAAAAGAAAGAGAGACGAAGTTGG
AGACAATGCTCAAGAGTAAGAAAATATTTAGGAAGATTAGCAATAATAAATAGCAGCAGA
AGATGAAAATGAAAATAATGATGAAGAAAACAATCAAGATGATGAACAAGGAGAAGATGA
AGAAGAAAGCCAAGAAGAGGCTGATCAAGCAAATAAAAAAGGAAAGCAAAATAAAAACAA
TAAGAAAGATAAAAGAAACAAATAATAAAACAATTAAAATGGCTCCAAACCTATCCCATA
ATTTATTAGACCATAAATAACTAAAGTAGTATATTCAAGTGGACCCAAAGAAATCAAAGG
TCATACTGGATATTTATCTTTTGGTATTTGTATTTGA