Identifiers and Description

Gene Model Identifier

TTHERM_00794490

Standard Name

CHN1 (CHitiNase 1)

Aliases

PreTt21448 | 134.m00128

Description

Chitinase class I family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 28.3%

TetraMine Data

TTHERM_00794490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13326.19.997093137033517e-262chitinase class I family prote
in (346 aa)
WormBaseWBGene000202700.00003998524687536623status:Partially_confirmed U
niProt:O16512 protein_id:CCD
72033.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794490(coding)
ATGTTTAATATCAAAATTTCACAAAGTATCGGCCTTGTGCTGATATTTACTACTCTTCTT
ATTACAGGAGGTATATTTATGAATGCTCTTAAGAAAGAAATCAATTAAGATGATGAAATG
TTTACTGAAACTGGAAGTCGTAATTTCAGCGTTTGGTTGAAAGGAATCAACATTCCTAAA
TCTCTTGAGCATATTGCTTATGTTTCTTAGGATAGAATTGACTAATGGCTCGTAGATATC
ACTAATGCTAGTAAGCAATATCCTACTTTCTGTAACACTGGAGATGATAAATTAGATAAG
TACGAATTTGCTGCTTTCTTGACTATTATTGGTTCTGAAACTGAATTCACTTATGGATTC
CCCTGTACTCACGAATAGGGTTGCCCAGATTGCACTCATTGCTCTTACAATACCAATGGT
CTTCAATGCCTTACTGATGATAAGCTTTAATATTTTGGCCGTGGTCCTGTTCAACTTTCA
TGGAATTACAATTATGCTGATTTTAGTTAAAGTTACTTTAAAGATGACAGACTTGTAAAA
AATCCTACTTTACTTGATAGCAACACTGAATTATGTTGGGCAAGCGCTGTTTGGTTCTGG
ATGGAAAGACACGATTATGGTGGCTGGTGCATGCCCTAAGCTGGTTGGGACTAGCACGAT
ACTTGTGATGCTAAGTGTCCTAATGGTCCAAGTGGATGCTAACTTAGTTAATGCTCAGAT
GCTCATTGGCTTCCTAGAAAGTAAGGTTCATGCCATGATGCTATGCACTCAAGTGGTTCT
ATCGGATAAGTCATTAATATCATTAATGGAGGTTATGATTGCTGTCCTACAACTACTTAC
TTTGCTGGCTTTGGCCATACTCTTAGAAGAACTGAATGGTGGGCTACCATAGTAGTTAAT
TGGGGATTAGGTCTTCCATGGACATAAGTAGACCCTGTACCTATTAATGAATGCCCTAGA
GCTGTTGGTCATATCAACTGTACTCCTCTTAAAGATAATCCTGAAAATTGTTGGACTTGT
TGCACTGAAAAGAATTGA


>TTHERM_00794490(protein)
MFNIKISQSIGLVLIFTTLLITGGIFMNALKKEINQDDEMFTETGSRNFSVWLKGINIPK
SLEHIAYVSQDRIDQWLVDITNASKQYPTFCNTGDDKLDKYEFAAFLTIIGSETEFTYGF
PCTHEQGCPDCTHCSYNTNGLQCLTDDKLQYFGRGPVQLSWNYNYADFSQSYFKDDRLVK
NPTLLDSNTELCWASAVWFWMERHDYGGWCMPQAGWDQHDTCDAKCPNGPSGCQLSQCSD
AHWLPRKQGSCHDAMHSSGSIGQVINIINGGYDCCPTTTYFAGFGHTLRRTEWWATIVVN
WGLGLPWTQVDPVPINECPRAVGHINCTPLKDNPENCWTCCTEKN


>TTHERM_00794490(gene)
TGTAGTCTAATAACTTAAATTAAGAATAACTAATTCAATTAGGATCTAAAAAGATATCAA
TCAATCAATCATTTTTTAGACATACAAAATATTATAAGCATGTTTAATATCAAAATTTCA
CAAAGTATCGGCCTTGTGCTGATATTTACTACTCTTCTTATTACAGGAGGTATATTTATG
AATGCTCTTAAGAAAGAAATCAATTAAGATGATGAAATGTTTACTGAAACTGGAAGTCGT
AATTTCAGCGTTTGGTTGAAAGGAATCAACATTCCTAAATCTCTTGAGCATATTGCTTAT
GTTTCTTAGGATAGAATTGACTAATGGCTCGTAGATATCACTAATGCTAGTAAGCAATAT
CCTACTTTCTGTAACACTGGAGATGATAAATTAGATAAGTACGAATTTGCTGCTTTCTTG
ACTATTATTGGTTCTGAAACTGAATTCACTTATGGATTCCCCTGTACTCACGAATAGGGT
TGCCCAGATTGCACTCATTGCTCTTACAATACCAATGGTCTTCAATGCCTTACTGATGAT
AAGCTTTAATATTTTGGCCGTGGTCCTGTTCAACTTTCATGGAATTACAATTATGCTGAT
TTTAGTTAAAGTTACTTTAAAGATGACAGACTTGTAAAAAATCCTACTTTACTTGATAGC
AACACTGAATTATGTTGGGCAAGCGCTGTTTGGTTCTGGATGGAAAGACACGATTATGGT
GGCTGGTGCATGCCCTAAGCTGGTTGGGACTAGCACGATACTTGTGATGCTAAGTGTCCT
AATGGTCCAAGTGGATGCTAACTTAGTTAATGCTCAGATGCTCATTGGCTTCCTAGAAAG
TAAGGTTCATGCCATGATGCTATGCACTCAAGTGGTTCTATCGGATAAGTCATTAATATC
ATTAATGGAGGTTATGATTGCTGTCCTACAACTACTTACTTTGCTGGCTTTGGCCATACT
CTTAGAAGAACTGAATGGTGGGCTACCATAGTAGTTAATTGGGGATTAGGTCTTCCATGG
ACATAAGTAGACCCTGTACCTATTAATGAATGCCCTAGAGCTGTTGGTCATATCAACTGT
ACTCCTCTTAAAGATAATCCTGAAAATTGTTGGACTTGTTGCACTGAAAAGAATTGA