Identifiers and Description

Gene Model Identifier

TTHERM_00794110

Standard Name

IDP2  (Isocitrate Dehydrogenase, NADP-specific )

Aliases

PreTt21410 | 134.m00090

Description

Cytosolic NADP-specific isocitrate dehydrogenase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01712 ) phage N-6-adenine-methyltransferase
  • ( TIGR00175 ) isocitrate dehydrogenase, NAD-dependent
  • ( TIGR00127 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR00183 ) isocitrate dehydrogenase, NADP-dependent
  • ( TIGR02088 ) isopropylmalate/isohomocitrate dehydrogenases
  • ( PF00180 ) dehydrogenase, isocitrate/isopropylmalate family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000103179.997093137033517e-262locus:idh-1 Isocitrate dehyd
rogenase [NADP] status:Confi
rmed UniProt:Q21032 protei
n_id:CAA92778.1
Tetrahymena borealisEI9_13286.19.997093137033517e-262dehydrogenase, isocitrate/isop
ropylmalate family protein (41
8 aa)
DictyBaseDDB_G02722089.997093137033517e-262idhC on chromosome: 2 position
1670009 to 1671569
OxytrichaContig13323.0.g139.997093137033517e-262Isocitrate/isopropylmalate deh
ydrogenase
SGDYLR174W9.997093137033517e-262IDP2 Cytosolic NADP-specific i
socitrate dehydrogenase, catal
yzes oxidation of isocitrate t
o alpha-ketoglutarate; levels
are elevated during growth on
non-fermentable carbon sources
and reduced during growth on
glucose

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00794110(coding)
ATGGCTGAACTCCAAAAGATTAAAGTTACTAACCCCGTTACTGAATTAGACGGTGATGAA
ATGACCAGAGTTATCTGGTAACTCATCAAGGATAAGCTCATTTTACCTTATCTTGACTTG
AACATCAAGTACTTCGATTTAGGTATGGAATACAGAGACTAAACTGACGATAAGGTCACC
CTTGATGCTGCTTAATCTATTGTTGAAACCAAGGTAGGTATCAAGTGTGCCACCATCACC
CCTGATGAAGCCAGAGTCAAGGAATTCAATCTTAAGAAGATGTGGAAATCCCCCAACGGT
ACCATCAGAAATCACATCGGAGGTACTGTCTTCAGAGAACCCATTCTCATGAAGAACGTC
CCTAGACTTGTTCCTGCTTGGACTAAGCCCATCGTTATCGGAAGACACGCTTTCGGTGAT
CAATACAGAGCCACTGACTTCAAGGTTGAAGAAGCTGGTACTTTTGAAATTGTCTTCACC
CCCAAGAATGGTGGTGAAAAGAAGGTCATGAAGGTCTTCGATTACCCTGCTGGTGGTGTT
GGTATGGGTATGTACAACACTGATGAATCTATTACTGAATTCGCCCACTCCAGTTTCAAG
TACGCTCTCGATAGAAAGATGCCCCTTTACTTATCTACCAAGAACACTATCTTGAAGGCT
TACGATGGTAAGTTCAAGGATATCTTCTAAGCTATCTATGACAAGTAATACAAGGAAGAA
TTCACCAAGGCTGGTATCTGGTATGAACACAGACTTATTGACGATATGGTCGCCTATATG
ATGAAGTCTGAAGGTGGTTTCATGTGGGCTTGCAAGAATTACGATGGTGATGTCCAATCT
GACTGTCTTGCTTAAGGTTTTGGTTCTCTTGGTTTAATGACCTCTGTCTTGGTTGGTCCT
AACGATATTATTGAAGCTGAAGCTGCTCACGGTACCGTTACCCGTCACTTCAGATAACAC
CAAAAGGGTCAAGAAACCTCCACTAACTCTATTGCCTCCATCTTCGCTTGGACCTAAGGT
TTATTACACAGAGCTAAGCTTGATAACAACAAGGAATTAGACCTCTTCTGCAAGACCCTT
GAAAGCTCAGTTATTGAAACTGTTGAAACTGGTTTCATGACTAAGGATCTCGCTATTTGC
ATCCAAGGAAGCAATGATGTACCCAGAAGCAAATATCTTACTACCCAAGAATTCATTGAC
AAGGTTGCTGAAACCCTCAGAAAGAACCTCGTTGCTGCTAAATCTAACCTCTGA


>TTHERM_00794110(protein)
MAELQKIKVTNPVTELDGDEMTRVIWQLIKDKLILPYLDLNIKYFDLGMEYRDQTDDKVT
LDAAQSIVETKVGIKCATITPDEARVKEFNLKKMWKSPNGTIRNHIGGTVFREPILMKNV
PRLVPAWTKPIVIGRHAFGDQYRATDFKVEEAGTFEIVFTPKNGGEKKVMKVFDYPAGGV
GMGMYNTDESITEFAHSSFKYALDRKMPLYLSTKNTILKAYDGKFKDIFQAIYDKQYKEE
FTKAGIWYEHRLIDDMVAYMMKSEGGFMWACKNYDGDVQSDCLAQGFGSLGLMTSVLVGP
NDIIEAEAAHGTVTRHFRQHQKGQETSTNSIASIFAWTQGLLHRAKLDNNKELDLFCKTL
ESSVIETVETGFMTKDLAICIQGSNDVPRSKYLTTQEFIDKVAETLRKNLVAAKSNL


>TTHERM_00794110(gene)
ATGGCTGAACTCCAAAAGATTAAAGTTACTAACCCCGTTACTGAATTAGACGGTGATGAA
ATGACCAGAGTTATCTGGTAACTCATCAAGGATAAGCTCATTTTACCTTATCTTGACTTG
AACATCAAGTACTTCGATTTAGGTATGGAATACAGAGACTAAACTGACGATAAGGTCACC
CTTGATGCTGCTTAATCTATTGTTGAAACCAAGGTAGGTATCAAGTGTGCCACCATCACC
CCTGATGAAGCCAGAGTCAAGGAATTCAATCTTAAGAAGATGTGGAAATCCCCCAACGGT
ACCATCAGAAATCACATCGGAGGTACTGTCTTCAGAGAACCCATTCTCATGAAGAACGTC
CCTAGACTTGTTCCTGCTTGGACTAAGCCCATCGTTATCGGTAAATATTTAACTCAATTT
ATTATATATTAAATGGAATAGTTTAATGGCTTCTTTTCTACCCGATAAACTTCTAATTGT
TTATTTAATATTCAGATTTAGATAACAATAATTTTTCAACAGAAGTTGATTAATTGCTTT
AGAATAATTTTGTGAATTTAAAAATATGTGTTATTTACTCTAATAATTACTATTAAATAG
GAAGACACGCTTTCGGTGATCAATACAGAGCCACTGACTTCAAGGTTGAAGAAGCTGGTA
CTTTTGAAATTGTCTTCACCCCCAAGAATGGTGGTGAAAAGAAGGTCATGAAGGTCTTCG
ATTACCCTGCTGGTGGTGTTGGTATGGGTATGTACAACACTGATGAATCTATTACTGAAT
TCGCCCACTCCAGTTTCAAGTACGCTCTCGATAGAAAGATGCCCCTTTACTTATCTACCA
AGAACACTATCTTGAAGGCTTACGATGGTAAGTTCAAGGATATCTTCTAAGCTATCTATG
ACAAGTAATACAAGGAAGAATTCACCAAGGCTGGTATCTGGTATGAACACAGACTTATTG
ACGATATGGTCGCCTATATGATGAAGTCTGAAGGTGGTTTCATGTGGGCTTGCAAGAATT
ACGATGGTGATGTCCAATCTGACTGTCTTGCTTAAGGTAACTAAAACTAATATTCATTTA
TTTAAAAAATAGTTAATTTAAATAAAGAAAGCAAAGATTGCTTAATACAATAGCTAGCTT
AATCAATCAAATAATCAATTTAGATATTAAAGCATAAATCAAGAAACCCTTTTTCTTTTA
TTTTAATTATTTGTTTATTTATTTGCTTACCGATCTTAATTTAAAAAGGAATTATTCATT
CAATTAAAGAATAAATATAGGTTTTAATCAAAAATATAGCTATCAAAAAACAAACAAATA
AATAAAGATTTCTTATTGTTGTATTTCTGATTAAAAGATTGATAAAGATTAATTTTATTT
AATTAATTATCAAATTAAATAAATCAAATCAAATCAAATCAAATAGTTCATACAAAATAA
ATAAATAATAATGATTTTATTCAACAAAAAAATAATTTTGATTCCTAAGCGAATTAACAA
ATAATCTTTGTTTATCCTCTAAAAACTTTAAAATAAACAATCTTTGAGCTCTTCTTTGTC
TTACTACTAATATTCTATTTAGACCTCTTTACTATTAATTAACTAATTATTTTAATTTTA
TAGGTTTTGGTTCTCTTGGTTTAATGACCTCTGTCTTGGTTGGTCCTAACGATATTATTG
AAGCTGAAGCTGCTCACGGTACCGTTACCCGTCACTTCAGATAACACCAAAAGGGTCAAG
AAACCTCCACTAACTCTATTGCCTCCATCTTCGCTTGGACCTAAGGTTTATTACACAGAG
CTAAGCTTGATAACAACAAGGAATTAGACCTCTTCTGCAAGACCCTTGAAAGCTCAGTTA
TTGAAACTGTTGAAACTGGTTTCATGACTAAGGATCTCGCTATTTGCATCCAAGGAAGCA
ATGAGTAAATTCAATTTTTTGCTTTTTGTTAAAAATTAAGTCATATATTAAAATTTAATT
AATTATAATTTTTTAAATATTAATAGTGTACCCAGAAGCAAATATCTTACTACCCAAGAA
TTCATTGACAAGGTTGCTGAAACCCTCAGAAAGAACCTCGTTGCTGCTAAATCTAACCTC
TGA