Identifiers and Description

Gene Model Identifier

TTHERM_00784620

Standard Name

None

Aliases

PreTt25566 | 131.m00139 | 3813.m01643

Description

general transcription factor IIB

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00784620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11437.19.997093137033517e-262hypothetical protein (690 aa)
WormBaseWBGene000066480.000000019990673443141236locus:ttb-1 Transcription in
itiation factor IIB status:C
onfirmed UniProt:O16991 pr
otein_id:CCD74279.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00784620(coding)
ATGGATTACTATCAATACTAATTACTGCTCTAGTCATAGTAGTAATAAAAATCTCAACAA
CAACAACTACCTCAAAATCAGCTCAACTCTATCTCGCATTTGATTGGAAGTCATTAAATT
CCTCTCTAATAACCTCAAATGTAAGCTGCTCCTTCTTCTAATATGTTTGCTTTACATTAA
CAAAATTTACTTTAAAACTAAACTAATTTTAAAGACAACTAATTTTTGGGATAACCTTCA
GTAAATGATTTTAACATGATTATGCAATAAAAGTCTTAACCCTTTATCGCTAACAATGAT
TCTACTTAACATGTTTAAAGTTTCCCTAATTCCTCCGCATTGCCTAACAGCTTGAACGGC
TGCGCTGATATCAGCTAGCAAGTTTTTTTTTAAAAGGCTATCTAAAATTAGTACATCAAT
AATATTCAATAAAATCGCGAAGACATTATTCGCAATTACATTAATATTATCTCCAGTAAT
AAAAATCGTAATCCTAGCAATGATAATCGAAATCGAAATCCAAGTAATGAAAATAGAAAT
CGAAATTATAGCAATGAAAATAGAAATTAAAATGAAATTTTAAATGCGTTACCTTCAGCT
TAAATCAATAACTTATTGTAATAATAAAATTCTTCTACTGCATAAAATTAATACAGTGCT
CCTTAACAATTATCAGCTGCTATCTAAAATTAAAAATAACAGTTGCTAGTTTAACAATAA
GTTCAACAACAATAGCCCTAGTAAAATAATTGGATTTAAAACAATACTTTGAGCTAAAGT
ATTCCTCTCCAATAGTAGCATCGACATTCGAATCATCATATGCATCATCATCATTAATAG
TAATAGATGAATATAGGCATTAACATGAATGAATTACCTGTAGCTATGTAAAATCAAGCT
AATTTTGATAAAAAGATTGCTCTCTAAACCAATTTTAATTTATCTGATCAATAAAAGATG
AATAGTAACATTAATTCTGATCCTTTGATTGATTCATTCGATTAAGAGAATAATAGACTT
TAACAACAAATTACTGGTTTGACCAGCAAATTATTGTAGTTAAATCAGAGCTAAGCTGAA
ATCTTAGCTCTCAACAACTACTAGGGAAATAAGGGAATTATTGAATACTTAGAATCTTAA
ATTTTACTCCTGACTTCTCAAAAAAAGTAAATCTTAGAATAAATTGAAAGTCTTTAAACC
CTCAAACTTGCTTATAGCAATTTCAGAAAAGTATGTCCTGATGGAAGTGCTGCTCAATTT
ATGAGTCTTTCTAAAGAAACTCAATTACTTTTCCTCAACTTAATTCCCAGCTCAAATAAT
TCCTTAGCTTCAGCACCTGTTTTGTAGTAAGCTCAAATACCTATGCCTAAAATAGAACAC
ACTCCTGTTCAACTATAATTCTCCACTGAAGCACAAAACTATTTGCAGGAAGGTTAATAG
TAACTTAGCTAAGACGACTAAAAATCTACTTCTTCTAAAAATTCTAGCTCTTCCAATTAA
AAGAAAAATCCTTTCAAGGTCATTCGCTCAAATGAAAACAGTGAGGATCCTGACATTGGT
TATATTAGCCGTAAAAGAGAAACTCCTGTTCAGTCACCATCTCTTTCAAAGGCTATGAAT
TAGGTATAAGATGTAGAAAATAACAAATAACAAACTTCAGAAAGCAATCAAAAAGATGCT
CCTTAAGCTGCTGTTTCTGAAAAGACTATATAGGAAAGCGCTTCAACTAAACCCCAATAA
ATTTAGGAGGATATTGTATAAAAGTAGAATGTTCAACAAATTGAAGCTGATAAAAAGAAT
GATGAATAAGAAGAAATAGAAATCAGAATTGATGAAGAAGAAGATGATGAAGAAAGAGAA
GAGAATACTATTGATAACGAAAACACTACTCAAGCCTAGACTTCAACAATCACTTTGGCT
TAAAAGCTCAGTGCTATGAATCCAGCTGAGAGTAAGAAATTCGAAAAGAGACGTGAAAAA
TTGGAAGAAAATGTAATCAAGATTCTTGAAAAATCTGAAGACGCTTGCTCTAAAATTAAG
CCTATCGCTCTTGAACTCTGCTCAAAAATTGCAGTTGAAGGCGACGTACTCAAAAATAGA
CCTTATGAAGCTATTTCTGCTGCAGTAATAGTTCACGCTTCCCGATTAGTCGCTAATCCC
ATCACCGTAAAGAAAATGGCTAAGATTACTGAATCTAAGGAAAAGATTATCAATCGCGTC
TTCATGTACCTAAAGAAGAACGTAGAAGGCTTCAATAACAAAATGCCTCAACCTGAAGTT
TTCATTAAGAACATTTGCGATAAGATGAAATTAAGTGAACCCATTTCCAAAACTGCATTC
TTCCTTCATTAATAATCAGATAACCTCGGTCTTGTTAAAGGATAGCATGCTGCTACTGTC
GCTGCTTGTATTGTGAAGTTAGCTGCCTGTTTGAATAATATGGAAATGACTGTCAAGTAG
ATTTGTGAAGCTTCTAACGTGTGCCAAATCTCATTAAGACAGCTTTATAGAACCATATAT
CCCCACAGATTTGAATTAATTGGCGATCATAAAATAAATGACATCGATTTTAAGAAAATC
TTGAACTCACCCTAAATGAATTTAGATTGA


>TTHERM_00784620(protein)
MDYYQYQLLLQSQQQQKSQQQQLPQNQLNSISHLIGSHQIPLQQPQMQAAPSSNMFALHQ
QNLLQNQTNFKDNQFLGQPSVNDFNMIMQQKSQPFIANNDSTQHVQSFPNSSALPNSLNG
CADISQQVFFQKAIQNQYINNIQQNREDIIRNYINIISSNKNRNPSNDNRNRNPSNENRN
RNYSNENRNQNEILNALPSAQINNLLQQQNSSTAQNQYSAPQQLSAAIQNQKQQLLVQQQ
VQQQQPQQNNWIQNNTLSQSIPLQQQHRHSNHHMHHHHQQQQMNIGINMNELPVAMQNQA
NFDKKIALQTNFNLSDQQKMNSNINSDPLIDSFDQENNRLQQQITGLTSKLLQLNQSQAE
ILALNNYQGNKGIIEYLESQILLLTSQKKQILEQIESLQTLKLAYSNFRKVCPDGSAAQF
MSLSKETQLLFLNLIPSSNNSLASAPVLQQAQIPMPKIEHTPVQLQFSTEAQNYLQEGQQ
QLSQDDQKSTSSKNSSSSNQKKNPFKVIRSNENSEDPDIGYISRKRETPVQSPSLSKAMN
QVQDVENNKQQTSESNQKDAPQAAVSEKTIQESASTKPQQIQEDIVQKQNVQQIEADKKN
DEQEEIEIRIDEEEDDEEREENTIDNENTTQAQTSTITLAQKLSAMNPAESKKFEKRREK
LEENVIKILEKSEDACSKIKPIALELCSKIAVEGDVLKNRPYEAISAAVIVHASRLVANP
ITVKKMAKITESKEKIINRVFMYLKKNVEGFNNKMPQPEVFIKNICDKMKLSEPISKTAF
FLHQQSDNLGLVKGQHAATVAACIVKLAACLNNMEMTVKQICEASNVCQISLRQLYRTIY
PHRFELIGDHKINDIDFKKILNSPQMNLD


>TTHERM_00784620(gene)
ATGGATTACTATCAATACTAATTACTGCTCTAGTCATAGTAGTAATAAAAATCTCAACAA
CAACAACTACCTCAAAATCAGCTCAACTCTATCTCGCATTTGATTGGAAGTCATTAAATT
CCTCTCTAATAACCTCAAATGTAAGCTGCTCCTTCTTCTAATATGTTTGCTTTACATTAA
CAAAATTTACTTTAAAACTAAACTAATTTTAAAGACAACTAATTTTTGGGATAACCTTCA
GTAAATGATTTTAACATGATTATGCAATAAAAGTCTTAACCCTTTATCGCTAACAATGAT
TCTACTTAACATGTTTAAAGTTTCCCTAATTCCTCCGCATTGCCTAACAGCTTGAACGGC
TGCGCTGATATCAGCTAGCAAGTTTTTTTTTAAAAGGCTATCTAAAATTAGTACATCAAT
AATATTCAATAAAATCGCGAAGACATTATTCGCAATTACATTAATATTATCTCCAGTAAT
AAAAATCGTAATCCTAGCAATGATAATCGAAATCGAAATCCAAGTAATGAAAATAGAAAT
CGAAATTATAGCAATGAAAATAGAAATTAAAATGAAATTTTAAATGCGTTACCTTCAGCT
TAAATCAATAACTTATTGTAATAATAAAATTCTTCTACTGCATAAAATTAATACAGTGCT
CCTTAACAATTATCAGCTGCTATCTAAAATTAAAAATAACAGTTGCTAGTTTAACAATAA
GTTCAACAACAATAGCCCTAGTAAAATAATTGGATTTAAAACAATACTTTGAGCTAAAGT
ATTCCTCTCCAATAGTAGCATCGACATTCGAATCATCATATGCATCATCATCATTAATAG
TAATAGATGAATATAGGCATTAACATGAATGAATTACCTGTAGCTATGTAAAATCAAGCT
AATTTTGATAAAAAGATTGCTCTCTAAACCAATTTTAATTTATCTGATCAATAAAAGATG
AATAGTAACATTAATTCTGATCCTTTGATTGATTCATTCGATTAAGAGAATAATAGACTT
TAACAACAAATTACTGGTTTGACCAGCAAATTATTGTAGTTAAATCAGAGCTAAGCTGAA
ATCTTAGCTCTCAACAACTACTAGGGAAATAAGGGAATTATTGAATACTTAGAATCTTAA
ATTTTACTCCTGACTTCTCAAAAAAAGTAAATCTTAGAATAAATTGAAAGTCTTTAAACC
CTCAAACTTGCTTATAGCAATTTCAGAAAAGTATGTCCTGATGGAAGTGCTGCTCAATTT
ATGAGTCTTTCTAAAGAAACTCAATTACTTTTCCTCAACTTAATTCCCAGCTCAAATAAT
TCCTTAGCTTCAGCACCTGTTTTGTAGTAAGCTCAAATACCTATGCCTAAAATAGAACAC
ACTCCTGTTCAACTATAATTCTCCACTGAAGCACAAAACTATTTGCAGGAAGGTTAATAG
TAACTTAGCTAAGACGACTAAAAATCTACTTCTTCTAAAAATTCTAGCTCTTCCAATTAA
AAGAAAAATCCTTTCAAGGTCATTCGCTCAAATGAAAACAGTGAGGATCCTGACATTGGT
TATATTAGCCGTAAAAGAGAAACTCCTGTTCAGTCACCATCTCTTTCAAAGGCTATGAAT
TAGGTATAAGATGTAGAAAATAACAAATAACAAACTTCAGAAAGCAATCAAAAAGATGCT
CCTTAAGCTGCTGTTTCTGAAAAGACTATATAGGAAAGCGCTTCAACTAAACCCCAATAA
ATTTAGGAGGATATTGTATAAAAGTAGAATGTTCAACAAATTGAAGCTGATAAAAAGAAT
GATGAATAAGAAGAAATAGAAATCAGAATTGATGAAGAAGAAGATGATGAAGAAAGAGAA
GAGAATACTATTGATAACGAAAACACTACTCAAGCCTAGACTTCAACAATCACTTTGGCT
TAAAAGCTCAGTGCTATGAATCCAGCTGAGAGTAAGAAATTCGAAAAGAGACGTGAAAAA
TTGGAAGAAAATGTAATCAAGATTCTTGAAAAATCTGAAGACGCTTGCTCTAAAATTAAG
CCTATCGCTCTTGAACTCTGCTCAAAAATTGCAGTTGAAGGCGACGTACTCAAAAATAGA
CCTTATGAAGCTATTTCTGCTGCAGTAATAGTTCACGCTTCCCGATTAGTCGCTAATCCC
ATCACCGTAAAGAAAATGGCTAAGATTACTGAATCTAAGGAAAAGATTATCAATCGCGTC
TTCATGTACCTAAAGAAGAACGTAGAAGGCTTCAATAACAAAATGCCTCAACCTGAAGTT
TTCATTAAGAACATTTGCGATAAGATGAAATTAAGTGAACCCATTTCCAAAACTGCATTC
TTCCTTCATTAATAATCAGATAACCTCGGTCTTGTTAAAGGATAGCATGCTGCTACTGTC
GCTGCTTGTATTGTGAAGTTAGCTGCCTGTTTGAATAATATGGAAATGACTGTCAAGTAG
ATTTGTGAAGCTTCTAACGTGTGCCAAATCTCATTAAGACAGCTTTATAGAACCATATAT
CCCCACAGATTTGAATTAATTGGCGATCATAAAATAAATGACATCGATTTTAAGAAAATC
TTGAACTCACCCTAAATGAATTTAGATTGA