Identifiers and Description

Gene Model Identifier

TTHERM_00780700

Standard Name

None

Aliases

PreTt01282 | 130.m00092 | 3738.m00028

Description

domain found in IF2B/IF5 protein; Domain found in IF2B/IF5 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01873 ) Domain found in IF2B/IF5
  • ( TIGR00100 ) hydrogenase nickel insertion protein HypA
  • ( TIGR00311 ) translation initiation factor aIF-2, beta

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00780700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18670.11.0004559842325763e-117domain found in IF2B/IF5 famil
y protein (198 aa)
WormBaseWBGene000105602.9995979253168707e-35locus:iftb-1 Eukaryotic tran
slation initiation factor 2 su
bunit 2 status:Confirmed U
niProt:Q21230 protein_id:CAB
00049.1
DictyBaseDDB_G02820356.999881090205667e-34eif2s2 on chromosome: 3 positi
on 5298628 to 5299779
SGDYPL237W1.0003081162615753e-33SUI3 Beta subunit of the trans
lation initiation factor eIF2,
involved in the identificatio
n of the start codon; proposed
to be involved in mRNA bindin
g
OxytrichaContig13824.0.g1002.9998215087698487e-30Domain found in IF2B/IF5
Stentor CoeruleusSteCoe_256468.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00780700(coding)
ATGACTGACGCTAAAATTAAAGATATTTAAGTTCTCGACTTCGGTAATATGAAGAAAAAA
ACTAAGAAGCCTGCTGCTACTGCATCAAAGACTGAAAATGATGATGCCAATAAAGCTCAA
GGTGAAAAGAAAGATTCTTAGGTTGATTCCTCAAAAAACCAAGAAATCCCAGTTGAAAAG
AAGGATTTCGAACCCTAATACTACCAACTTTTAGATAGAATTAATGACATTTTAAAGAGA
AATAATCCAAGTTTACAAGAGGGTAAGACAAAAATTAGTATCAAGACTCCTCAAATTGAA
AAAATGGGTAAGAAAACTGCTTGGTTAAACTTTATGGATATTGTTAACAAGATGAAGAGA
GATCCCCAACATGTTTAATAATTCGTTGTTACAGAACTTGGTACTGAAGGTACTATAGCT
AACAATCAACTTATTTTAAAGAGCAGCAAGTTCAATGATAAGCATTTTGAATCAATTATC
AAGAAATATATTGCTGAATACGTTTAATGCTCACTTTGTAAGAGTCCTAACACTAAACTT
ACTAAGGATACCAATACTCGTCTATTCATGATTGAATGTGATCAATGTAAAAGTTCTAGA
TCCGTCGCTACTATTAAGAAGCATTGA


>TTHERM_00780700(protein)
MTDAKIKDIQVLDFGNMKKKTKKPAATASKTENDDANKAQGEKKDSQVDSSKNQEIPVEK
KDFEPQYYQLLDRINDILKRNNPSLQEGKTKISIKTPQIEKMGKKTAWLNFMDIVNKMKR
DPQHVQQFVVTELGTEGTIANNQLILKSSKFNDKHFESIIKKYIAEYVQCSLCKSPNTKL
TKDTNTRLFMIECDQCKSSRSVATIKKH


>TTHERM_00780700(gene)
ATGACTGACGCTAAAATTAAAGATGTAACTAATTATATAAATTTTTAGATTATAAACATA
GAATTTGCATATTACATCTAAAATATCACAATAGATAAAATTTAAAATATTTTAGAATTT
TGTTTTTCATTATGAGATTATCATTCAATAATTGAATATTAATTTGCGTAATTTTTCAGA
TAAAATAAACTTGTTTTTATTTTTTATAAAGATTTAAGTTCTCGACTTCGGTAATATGAA
GAAAAAAACTAAGAAGCCTGCTGCTACTGCATCAAAGACTGGTAAATAAATAAACAAATA
TATTTTTATTTATTTTTATCATAACAAAACATAAATTAATTATATTTTTAATATATTTAT
AGAAAATGATGATGCCAATAAAGCTCAAGGTATATATATTAGCTTTAAAATTAGAAATAA
TTAATTATGGAATAGATTATATAATATATATTCCTAAATTCATTGAACTACACTTAACAT
TTACAATTTAGAATTGTATTAAATCATTTATGAATTTTTCTGTATTATTAATAAAGGTGA
AAAGAAAGATTCTTAGGTTGATTCCTCAAAAAACCAAGAAATCCCAGTTGAAAAGAAGGA
TTTCGAACCCTAATACTACCAACTTTTAGATAGAATTAATGACATTTTAAAGAGAAATAA
TCCAAGTTTACAAGGTATGATTCATATATTCTTTATTGCTTAATTATTAAAAATTAAAAG
AATGAGTAAGAAGAAAAAAGCAAATTACAAAAAAAATCAAATATATTATTTATATTTGAT
ATATAAGTTTGCTAAACGAAAATATTGATTTTTACAGTCTAAATAATGAAAAAAAACGAA
TTATAGTCAATAAATGAGCTAATTATATTGCATCCTCTATTAAAACTTAGAATATATATA
TTCACCATTAAGAAATTTATAATTCATTTTCAATAATATTTGATTTAGAAGCTAAATAAA
TAAATAAATTTCTACAATTTTACAAAAAAAATTCGATAAAATCATTATTTATTTTTTTTT
TAATAAAAGAGGGTAAGACAAAAATTAGTATCAAGACTCCTCAAATTGAAAAAATGGGTA
AGAAAACTGCTTGGTTAAACTTTATGGATATTGTTAACAAGATGAAGAGAGATCCCCAAC
ATGTTTAATAATTCGTTGTTACAGAACTTGGTACTGAAGGTACTATAGCTAACAATCAAC
TTAGTAAGAAAAAAATCTATTTAAATTCCAAAATATATCAATTAATCCGTTTTATATTTT
ATTATCTTAGTTTTAAAGAGCAGCAAGTTCAATGATAAGCATTTTGAATCAATTATCAAG
AAATATATTGGTAAAATATTCACTTTTTATATAGCAATCAATTTAAATTTTTATATGAAC
TTTAAAGCTGAATACGTTTAATGCTCACTTTGTAAGAGTCCTAACACTAAACTTACTAAG
GATACCAATACTCGTCTATTCATGATTGAATGTGATCAATGTAAAAGTTCTAGGTAAATT
AATTTTGAAAATTTTATTATATTCAATTTAACTTTAAATTATAAGATCCGTCGCTACTAT
TAAGAAGCATTGA