Identifiers and Description

Gene Model Identifier

TTHERM_00773520

Standard Name

None

Aliases

PreTt04443 | 128.m00121 | 3676.m00046

Description

XPG I-region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00867 ) XPG I-region
  • ( PF00752 ) XPG N-terminal domain
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF08133 ) Anticodon nuclease activator family
  • ( PF02739 ) 5'-3' exonuclease, N-terminal resolvase-like domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00773520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17671.19.997093137033517e-262XPG I-region family protein (6
24 aa)
OxytrichaContig8213.0.g268.002162267243937e-73XPG I-region
SGDYOR033C1.9991939848149086e-44EXO1 5-3 exonuclease and flap-
endonuclease involved in recom
bination, double-strand break
repair and DNA mismatch repair
; member of the Rad2p nuclease
family, with conserved N and
I nuclease domains
DictyBaseDDB_G02915703.998777993244535e-41exo1 on chromosome: 6 position
561048 to 564580
WormBaseWBGene000097313.000842737734004e-34locus:exo-1 status:Confirmed
UniProt:O62245 protein_id
:CAB07612.2
Stentor CoeruleusSteCoe_330405.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00773520(coding)
ATGGGAATTTAAGGACTTTAAAACTTAATTAAACCTGCTTTAGAGTTCACCTCTCTACAT
TAATTCAAAGGATAAAAAGCTGCAATCGATGCAATGTCTTTTTTATATAAGGGATGCTAT
GGCTATTCATATTAATTAAACAAGGGAGAATAAACAAGAGAATATATGTTATTTTTATTG
CGCATAGTAAGAGTAGTTAAGCTTAACGGAATTGAACCTATAGTAGTATTTGACGGGAGG
AATTTAAAAGCAAAAGATTTCACTATCAAAAAAAGAGAAGAAACAAAAGAAAAAAATTTA
TAAAAAGCAAATGAATTGATGGAATAAGGAAATAAAAATGAGGCTATTAAATACTATCAA
AGATGTTTAAGAGTGAATAAAGAAATGATTTATGACACAATAGATATGTTAAGGGCTAAC
AATATTGAATATTTAATTTCTCCTTATGAGGCAGATTCTTAAGTAGCTTATTTAGTCAAA
TCTTAATAAGCAGATTTTGCAATTACAGAAGACTCTGATTTAATATGTTATTCTTGTCCT
AAAATAGTGTTTAAACTATCACTTGATTCTTCTTGTTAGTACTTAGATCTACTAAAATAC
TGTAATTCTTTGTAGGAAAGAAGTAATTTGCAAAGTGAAGCTCTAAGGTGCTTCTTGAGT
TAGAATGAATTAAACAGAATCTACATATGCATAATGGCAGGATCTGATTACTTTCCAAGT
ATTTAAGGAATTGGTATTAAAAAGGCTATTGACTTGTTTTATAGATGTGGAACTTTCAAA
AATGTTATGTAAAAGCTAAGATTAGAACCTAAGATTAGGCCTCTTATTCCTGAGAATTAT
GATATGTTTGTCGAAAAAGTAGCTTTGATATTTAGGTATTAGAGGGTATTTGACATGAAT
ACTAAGTAACTGATAACATTAAATCCTGTTCCTGAAGATTTTTCTTAAGAAGATGAAAGG
CTTATTGGCGAGCAAATCCCTCATTTTGATGAAGTTAGTTAAGGATTGCGACACATTTAT
AGTTTAGAAAAAAGAGAGCTAGTTGAAATAGATATGAAAACATACTTTACTTCTAAATCA
GAAAAGAAGAAATTCATAATTTAAGCTTAAAATAATTCGACTAATAATGATTTCAGCAAT
TTATAACAAACAAATGAAAATGAAAAATTGCATTATAATTAATACTAGGTAAATTCTGAT
CAAATAAAGAAGTTACTAAAACCTCAAGAAGTTTAATAGCTATAGGAGTTAAAAAAGAAG
TAAGAGGAAGAGTTATATGAATTAATAGATACATATAATGAAGAATTGGGAGATTTTAAT
TTTGATAACGCAAATAATTAAGATGAAAACCCTAATGGAGAAGATGAAAACTTTGCTAAA
TTTGGATAAAGTTATTTATATAGTGATGATTTTTAAATTTAAAAAAAGAACAATTCTGAT
TATACTTCTTATTTAGAAAACCTATGTAATTCTTTTTTACAAGATTACTAGTAATTTTTA
AAGAATGAAGATTCTCAAGTGAGAGTTTAAACTTAAATTGTTAGGAGAGCTAGTTCTAAC
TTAAATGAATAATAAGAAAACTAAGATATAAATAATTAAGAAAATTAAAATAAAAAAACA
ATATTACACAATCCCTTTGCTAAAAAATCCAATAAATTAAACTCTTATTAACCTGACTCT
CTTGATGATTTAAATTTATAAAGAAAATTAAGTCCTTCCAAAACACCATCAAAAAAAGTT
ATCTCAGACAACAAATTTATGTATAAAGATGAAGCAAATATGTAAAATTCTAATGAAAAA
TATTCAAATCAAAAAAGTAATTCATAAAAAAAAGTGACAATGAAAGACTTCTTTTCTAAG
AAAAAGTGA


>TTHERM_00773520(protein)
MGIQGLQNLIKPALEFTSLHQFKGQKAAIDAMSFLYKGCYGYSYQLNKGEQTREYMLFLL
RIVRVVKLNGIEPIVVFDGRNLKAKDFTIKKREETKEKNLQKANELMEQGNKNEAIKYYQ
RCLRVNKEMIYDTIDMLRANNIEYLISPYEADSQVAYLVKSQQADFAITEDSDLICYSCP
KIVFKLSLDSSCQYLDLLKYCNSLQERSNLQSEALRCFLSQNELNRIYICIMAGSDYFPS
IQGIGIKKAIDLFYRCGTFKNVMQKLRLEPKIRPLIPENYDMFVEKVALIFRYQRVFDMN
TKQLITLNPVPEDFSQEDERLIGEQIPHFDEVSQGLRHIYSLEKRELVEIDMKTYFTSKS
EKKKFIIQAQNNSTNNDFSNLQQTNENEKLHYNQYQVNSDQIKKLLKPQEVQQLQELKKK
QEEELYELIDTYNEELGDFNFDNANNQDENPNGEDENFAKFGQSYLYSDDFQIQKKNNSD
YTSYLENLCNSFLQDYQQFLKNEDSQVRVQTQIVRRASSNLNEQQENQDINNQENQNKKT
ILHNPFAKKSNKLNSYQPDSLDDLNLQRKLSPSKTPSKKVISDNKFMYKDEANMQNSNEK
YSNQKSNSQKKVTMKDFFSKKK


>TTHERM_00773520(gene)
ATGGGAATTTAAGGACTTTAAAACTTAATTAAACCTGCTTTAGAGTTCACCTCTCTACAT
TAATTCAAAGGATAAAAAGCTGCAATCGATGCAATGTCTTTTTTATATAAGGGATGCTAT
GGCTATTCATATTAATTAAACAAGGGAGAATAAACAAGAGAATATATGTTATTTTTATTG
CGCATAGTAAGAGTAGTTAAGCTTAACGGAATTGAACCTATAGTAGTATTTGACGGGAGG
AATTTAAAAGCAAAAGATTTCACTATCAAAAAAAGAGAAGAAACAAAAGAAAAAAATTTA
TAAAAAGCAAATGAATTGATGGAATAAGGTAAAAATAATTATATCAATTTTAAAATAATG
ATAACTTCTTTTTGTAGGAAATAAAAATGAGGCTATTAAATACTATCAAAGATGTTTAAG
AGTGAATAAAGAAATGATTTATGACACAATAGATATGTTAAGGGCTAACAATATTGAATA
TTTAATTTCTCCTTATGAGGCAGATTCTTAAGTAGCTTATTTAGTCAAATCTTAATAAGC
AGATTTTGCAATTACAGAAGACTCTGATTTAATATGTTATTCTTGTCCTAAAATAGTGTT
TAAACTATCACTTGATTCTTCTTGTTAGTACTTAGATCTACTAAAATACTGTGTAAAATA
TAATTTTGATTTATATTTAAGCAAGTTCTTTAATTATTTGAATTTTAAGAATTCTTTGTA
GGAAAGAAGTAATTTGCAAAGTGAAGCTCTAAGGTGCTTCTTGAGTTAGAATGAATTAAA
CAGAATCTACATATGCATAATGGCAGGATCTGATTACTTTCCAAGTATTTAAGGAATTGG
TATTAAAAAGGCTATTGACTTGTTTTATAGATGTGGAACTTTCAAGTATATTTTATATTT
TAAAAGATGCACTAGTGTAAAATAATTTTTTTATAAGAAATGTTATGTAAAAGCTAAGAT
TAGAACCTAAGATTAGGCCTCTTATTCCTGAGAATTATGATATGTTTGTCGAAAAAGTAG
CTTTGATATTTAGGTATTAGAGGGTATTTGACATGAATACTAAGTAACTGATAACATTAA
ATCCTGTTCCTGAAGATTTTTCTTAAGAAGATGAAAGGCTTATTGGCGAGCAAATCCCTC
ATTTTGATGAAGTTAGTTAAGGATTGCGACACATTTATAGTTTAGAAAAAAGAGAGCTAG
TTGAAATAGATATGAAAACATACTTTACTTCTAAATCAGAAAAGAAGAAATTCATAATTT
AAGCTTAAAATAATTCGACTAATAATGATTTCAGCAATTTATAACAAACAAATGAAAATG
AAAAATTGCATTATAATTAATACTAGGTAAATTCTGATCAAATAAAGAAGTTACTAAAAC
CTCAAGAAGTTTAATAGCTATAGGAGTTAAAAAAGAAGTAAGAGGAAGAGTTATATGAAT
TAATAGATACATATAATGAAGAATTGGGAGATTTTAATTTTGATAACGCAAATAATTAAG
ATGAAAACCCTAATGGAGAAGATGAAAACTTTGCTAAATTTGGATAAAGTTATTTATATA
GTGATGATTTTTAAATTTAAAAAAAGAACAATTCTGATTATACTTCTTATTTAGAAAACC
TATGTAATTCTTTTTTACAAGATTACTAGTAATTTTTAAAGAATGAAGATTCTCAAGTGA
GAGTTTAAACTTAAATTGTTAGGAGAGCTAGTTCTAACTTAAATGAATAATAAGAAAACT
AAGATATAAATAATTAAGAAAATTAAAATAAAAAAACAATATTACACAATCCCTTTGCTA
AAAAATCCAATAAATTAAACTCTTATTAACCTGACTCTCTTGATGATTTAAATTTATAAA
GAAAATTAAGTCCTTCCAAAACACCATCAAAAAAAGTTATCTCAGACAACAAATTTATGT
ATAAAGATGAAGCAAATATGTAAAATTCTAATGAAAAATATTCAAATCAAAAAAGTAATT
CATAAAAAAAAGTGACAATGAAAGACTTCTTTTCTAAGAAAAAGTGA