Identifiers and Description

Gene Model Identifier

TTHERM_00770740

Standard Name

None

Aliases

PreTt13916 | 127.m00079

Description

zinc finger protein putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00770740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05636.19.99955252024689e-165hypothetical protein (309 aa)
OxytrichaContig21043.0.1.g212.999758165421992e-18Topoisomerase DNA binding C4 z
inc finger
DictyBaseDDB_G02708160.000000000000001999258566166494DDB_G0270816 on chromosome: 1
position 4879000 to 4880597
WormBaseWBGene000220190.00000000002000577768187062locus:sut-2 Zinc finger CCCH
domain-containing protein 14
status:Partially_confirmed
UniProt:Q95XU6 protein_id:C
CD71770.1
SGDYGL122C0.000004000864880866421NAB2 Nuclear polyadenylated RN
A-binding protein required for
nuclear mRNA export and poly(
A) tail length control; binds
nuclear pore protein Mlp1p; au
toregulates mRNA levels; relat
ed to human hnRNPs; nuclear lo
calization sequence binds Kap1
04p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00770740(coding)
ATGACATAGCGCGGTGATTTAAAATAATATTTTGACGAAAAAGAAGTTTAAAGTGAGCTT
TAGGGAATCATTTCCCAAATTTAGAATCTTTAACCAGAAGCACAGGAAATTATTACAACC
TATTGCATTTAGTGGTTCTAATCATTCTTCGACTCCCAATGTGAAGTAGAAGACTTTTTG
GGTGAAATCAAAAAGCTAGAAGAACCTGAATGTGAATAAAAGTTGTTGGAATTTATCAAA
AAGAAAATATCTCAAATGGAAAGCAAGTCTAAGAAAGCAAAAGAGGAGAGTAATACTTCT
GCTAAGGCTTCAACCATCCATGACAGAATTAAACCAAAGGGTAACAGCAACAATGCTAAT
TCTGGTGCTAAAAATTAAGAAAATCCTCAAACAAACTAACCTACTACAAAGAAATTTGTA
AAAATATTAGAAAAAGACGAATAAAAGCTAAAAAAAGCAAATGAAGCTGTTGAAAATAAA
AACAATGCAAATAACAACTAAAATAATAACTCATCCAATGCTAATAACTAAGAAGAAAGT
GATGAATATTTAATTAAAGAACTAGAAGACAAGAAGAAACAAAGATGTAAATATTATCCC
AATTGTAAAAATGAAAAAACTTGCCCATACATTCATCCAACTGAACCTTGCACTTTCTTC
CCTACTTGTAAGTATGGTTCTCAGTGTATAAATAAGCATCCTGATTGCAAATATGGTAAA
TCATGCCAAAGACCTGATTGTTTCTACGAGCACCCTTTCCCAAAAAAGCAAGCCATAAAT
CCTTTCCTATAAATGTTAATGATGCCTATGATGAATGCCTCTAAGAGAAAGATTACTAAT
AAGCCAAACGGTAAAAGACCTTTCCCTGGAAACACCCCAGGATAATTACAAGGTGGTGAA
GATTAAAAATCTGAAGATAAGCAATAATAACCTTGA


>TTHERM_00770740(protein)
MTQRGDLKQYFDEKEVQSELQGIISQIQNLQPEAQEIITTYCIQWFQSFFDSQCEVEDFL
GEIKKLEEPECEQKLLEFIKKKISQMESKSKKAKEESNTSAKASTIHDRIKPKGNSNNAN
SGAKNQENPQTNQPTTKKFVKILEKDEQKLKKANEAVENKNNANNNQNNNSSNANNQEES
DEYLIKELEDKKKQRCKYYPNCKNEKTCPYIHPTEPCTFFPTCKYGSQCINKHPDCKYGK
SCQRPDCFYEHPFPKKQAINPFLQMLMMPMMNASKRKITNKPNGKRPFPGNTPGQLQGGE
DQKSEDKQQQP


>TTHERM_00770740(gene)
ATGACATAGCGCGGTGATTTAAAATAATATTTTGACGAAAAAGAAGTTTAAAGTGAGCTT
TAGGGAATCATTTCCCAAATTTAGAATCTTTAACCAGAAGCACAGGAAATTATTACAACG
TAAATCTTGTTAGAATTAAATTTATTTATTGTCTTTATTATTATTTAAAGTGACTGAAAT
ACTCATAAAAAATATAAATTTATCAAATTTATAATTTATTTTTAACAAATAGCTATTGCA
TTTAGTGGTTCTAATCATTCTTCGACTCCCAATGTGAAGTAGAAGACTTTTTGGGTGAAA
TCAAAAAGCTAGAAGAAGTATTTTAAATTATTTCTTTAATTTTTAGACACAAAATTTATA
ATCAATGAATAAGTGTCTCTCAAAATTAAAGAGATAAAAATTTTAACTTTTATTTAACTT
ATAAAAAGCCTGAATGTGAATAAAAGTTGTTGGAATTTATCAAAAAGAAAATATCTCAAA
TGGAAAGCAAGTCTAAGAAAGGTAAAATAACTAGTTTATGACACTTTAGAAATAAATTTA
TTTATTTAAAGTAGTCAGTCAAGCAAATACATACTTAATATTAATTTTAAATAAACAGCA
AAAGAGGAGAGTAATACTTCTGCTAAGGTATACACTACTTAATAATAATTAATCCATTGA
TTTCCTTCATCAAAATGAATCTAGATTTACAAATTAACTAAGATTCTCTGATTTAAAACC
ATAAATAATTACAAGCATCTTCTATTCGCAATTAATTTTGATTGATTAAAAATGAATAAA
TAAGTAGGTTGATTGATTGATTGACTATGATGAATAAGAAATTTATTTATCAGTTAATGA
TTTATTTAGAGTAAATCTAATCAAGTAAATAAAAATTGATCGATTAAGCAATAGAAAATA
GCATCCATTAAACGAATAGCAGTTTCTTTTTGGCTGACTAAAAATTAAGTCAATTTAATC
TGCAGACTGAACTTACAAGAAAGAAAATCTATTTTTATACTTAACCAAATTATTCACCTC
TATTATTGATTAGTTTCTTTATCTTTGCTAAAAAAAATTTAATCAATCTAAAGCAATCAA
ACAAACATCTACATACATACAAACAAACATAAAATAAATCCTAATAGATGAAATATATGA
ATGAGATGATAAATTTAATCACTTATTTATTTGAGATTGATCACCATAAATTACGAAATT
TAACTGCTTTACTTACTTACTTACATACATACACACTGGCTCTTTCTCTCTTCAAAATTC
GTGGCTGACCTCCTCTTTCCGTGATTCCTACCACTGCTGAATCGAAGAGAGACAGAGCAA
ACCCCATAAAAAATAAAAAAATTTCCAAAATAAAATAAAAAGGAAGAAGTAAAAATAAAA
AATGGAATAAATAAAATAAAAAAAATTTTAAATAAAATACCAAAAAAAAATATTAAAAAA
AAATACTTCCTCCATCAAAAAAAAAATAAAATTTTTATTTCATCTAAAACTTATTAAAAA
AATTAAAAAAAAAATAAGCAATAAAATAAAAAACCTCCTCAAGAAAACTAATAAACCTCA
TTCTAAATTATTATAAAAAAGGCTTCAACCATCCATGACAGAATTAAACCAAAGGGTAAC
AGCAACAATGCTAATTCTGGTGCTAAAAATTAAGAAAATCCTCAAACAAACTAACCTACT
ACAAAGAAATTTGTGTAAATTAAAAATATATGAAAACTCCATAAAAAAAAACATTTTCTT
ACTTACATATATCAAGAAAAATATTAGAAAAAGACGAATAAAAGCTAAAAAAAGCAAATG
AAGCTGTTGAAAATAAAAACAATGCAAATAACAACTAAAATAATAACTCATCCAATGCTA
ATAACTAAGAAGAAAGTGATGAATATTTAATTAAAGAACTAGAAGACAAGAAGAAACAAA
GATGTAAATATTATCCCAATTGTAAAAATGAAAAAACTTGCCCATACATTCATCCAACTG
AACCTGTAATTCATTCTCAAAAACTATTTATTTTTATATAAACAAATAAATAATTTTAAT
TAATTAGTGCACTTTCTTCCCTACTTGTAAGTATGGTTCTCAGTGTATAAATAAGCATCC
TGATTGCAAATATGGTAAATCATGCCAAAGACCTGATTGTTTCTACGAGCACCCTTTCCC
AAGTAAAAATAAATACAATTTTGAAGAAATTCAATTAACAATATTTTATTAAACAGAAAA
GCAAGCCATAAATCCTTTCCTATAAATGTTAATGATGCCTATGATGAATGCCTCTAAGAG
AAAGATTACTAATAAGCCAAACGGTAAAAGACCTTTCCCTGGAAACACCCCAGGATAATT
ACAAGGTGGTGAAGATTAAAAATCTGAAGATAAGCAATAATAACCTTGA