Identifiers and Description

Gene Model Identifier

TTHERM_00766500

Standard Name

None

Aliases

PreTt03343 | 126.m00141 | 3740.m00065

Description

ribosome recycling factor family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00210 ) Ferritin-like domain
  • ( PF03406 ) Phage tail fiber repeat
  • ( PF01765 ) ribosome recycling factor
  • ( TIGR00496 ) ribosome recycling factor
  • ( TIGR00741 ) ribosomal subunit interface protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00766500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15944.12.9991470337942304e-139ribosome recycling factor fami
ly protein (262 aa)
OxytrichaContig20005.0.g623.001003044337619e-17Ribosome recycling factor
DictyBaseDDB_G02685180.000000000000001999258566166494DDB_G0268518 on chromosome: 1
position 810583 to 811472

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00766500(coding)
ATGAACAAACTAGTAGAAGCAAGTAAAGGAATGCTAAAAAGTAGAGCTCTTGCATTCTTT
AAAAATGGCTTGATAAATTAAAGAAGACAGAACTTTTTTGTTTTGTAGAAGATTAACAAA
CAATAAAACTTTTTAAGCATAGCTCAATTTGATTTTTCTACAAAAGTTGGCAAGAAAAAA
TAAGAAAAGATTGAAAAGCAAAAAGAAAAGGAAACTAGAGAAACTCCTTAAGGCACTATT
GATTTAACTCCTGTTGAAGAAACCATGAAGGCATAATTAGATCATACTAAAGCTGAATTA
GCTAAACTTAAAACTGGTAGACTGACTCCAGATATGTTCGAAAAGTTATCTGTTGTTGCT
TATGGCGAAAAAACTCCTTTAACTGAGCTATGTTAAATAGTATCTAAGGCTGTTACTACA
GTTTAATTAAATATCTATGATGATGCCTTAGTAGGTGCTATTCACAAAATTTTAGAAAAT
TCTGATTTGAATCTCTAATTGAAGAGAGAAGGCAAAATAATAACCTGCACAATGGTAGGA
GGAAATACCAAGGAAATTAAAGATGCAACTATTAAAGCTGCTAAGAGTGTTGTTGATAAA
GCTAAAAATTTACTCAGAAAACACCGTTAAACTGGTCAGGATATGATCAAGGGATATAAG
AAATTCGAAAGCGAGGATTTCATTAAAGAAGCTGAAAAAGAAGTTGATAATATTCACAAT
AAATTCGTTGCTGAATTAGATAATTTATTGAAAATCAAAGAAAAAGAAATTATTTCTTCT
TGA


>TTHERM_00766500(protein)
MNKLVEASKGMLKSRALAFFKNGLINQRRQNFFVLQKINKQQNFLSIAQFDFSTKVGKKK
QEKIEKQKEKETRETPQGTIDLTPVEETMKAQLDHTKAELAKLKTGRLTPDMFEKLSVVA
YGEKTPLTELCQIVSKAVTTVQLNIYDDALVGAIHKILENSDLNLQLKREGKIITCTMVG
GNTKEIKDATIKAAKSVVDKAKNLLRKHRQTGQDMIKGYKKFESEDFIKEAEKEVDNIHN
KFVAELDNLLKIKEKEIISS


>TTHERM_00766500(gene)
ATGAACAAACTAGTAGAAGCAAGTAAAGGAATGCTAAAAAGTAGAGCTCTTGCATTCTTT
AAAAATGGCTTGATAAATTAAAGAAGACAGAACTTTTTTGTTTTGTAGAAGATTAACAAA
CAATAAAACTTTTTAAGCATAGCTCAATTTGATTTTTCTACAAAAGTTGGCAAGAAAAAA
TAAGAAAAGATTGAAAAGCAAAAAGAAAAGGAAACTAGAGAAACTCCTTAAGGCACTATT
GATTTAACTCCTGTTGAAGAAACCATGAAGGCATAATTAGATCATACTAAAGTATGAACA
ACTTCATATTTTTTTAAGAATTTGTTATTATAAAATAAAATTTTAATTTAATGCTATTAG
CAGACATACTTATTATAAATATTTTAACTCAAAGAAAATTTGCCGTTTTTATTGTTAGAT
ACATAAATAGCTTATTTATTAATCTATTATTATATATTTTTCAATTAAGTTTATTAAATA
TATTATAAATAAGGCTGAATTAGCTAAACTTAAAACTGGTAGACTGACTCCAGATATGTT
CGAAAAGTTATCTGTTGTTGCTTATGGCGAAAAAACTCCTTTAACTGAGCTATGTTAAAT
AGTATCTAAGGCTGTTACTACAGTTTAATTAAATATCTATGATGATGCCTTAGTAGGTGC
TATTCACAAAGTAAGTTAAATATTTCTTACTTTGAATAAATAATGAATGAATTAATATAG
TTATAAATACTTGTTTATTAACTTTAAAATAATATTAATCAAGATTTTAGAAAATTCTGA
TTTGAATCTCTAATTGAAGAGAGAAGGCAAAATAATAACCTGCACAATGGTAGGAGGAAA
TACCAAGGAAATTAAAGATGCAACTATTAAAGCTGCTAAGAGTGTTGTTGATAAAGCTAA
AAATTTACTCAGAAAACACCGTTAAACTGGTCAGGATATGGTAAGTTATTGAAAATATAT
TATTTAAATGGGATTTTGTATTAAAAATTAAAAATTTTTTAACTAAATAAATAAATAAAT
AGATCAAGGGATATAAGAAATTCGAAAGCGAGGATTTCATTAAAGAAGCTGAAAAAGAAG
TTGATAATATTCACAATAAATTCGTTGCTGAATTAGATAATTTATTGAAAATCAAAGAAA
AAGAAATTATTTCTTCTTGA