Identifiers and Description

Gene Model Identifier

TTHERM_00766460

Standard Name

Anqa1

Aliases

PreTt03339 | 126.m00137 | 3740.m00061

Description

Tesmin/TSO1-like CXC domain containing protein. Homolog of human Lin54. Tetrahymena contains at least 14 Lin54-like genes, named Anqa1-14 (Nabeel-Shah et al. 2021).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.1%

TetraMine Data

TTHERM_00766460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15947.19.997093137033517e-262tesmin/TSO1-like CXC domain-co
ntaining protein (539 aa)
DictyBaseDDB_G02815199.00228338670803e-35lin54 on chromosome: 3 positio
n 4464773 to 4467683
WormBaseWBGene000030379.99723014177113e-33locus:lin-54 Protein lin-54
status:Partially_confirmed
UniProt:Q95QD7 protein_id:C
AB05229.1
OxytrichaContig10636.0.g799.99967697349061e-30Tesmin/TSO1-like CXC domain
Stentor CoeruleusSteCoe_228652.3195228302435696e-16

General Information

Paragraph NoGene NameParagraph Text
149Anqa1Anqa1 is homolog of human Lin54, subunit of MuvB complex. In Tetrahymena putative MuvB complex contains three conserved subunits including RebL1, Lin9 and Anqa1 (putative orthologs of human Rbbp4/7, Lin9 and Lin54, respectively). Additionally, two divergent subunits Jinn1 and Jinn2 are precited to be part of this putative MuvB in Tetrahymena. RebL1, Lin9 and Anqa1 reciprocally co-purified with each other during vegetative growth and conjugation. Additionally, IPRA1 and Myb-like proteins interacted with Anqa1 and RebL1. Human MuvB-complex regulates cell-cycle gene expression by forming either DREAM- or B-Myb-MuvB (MMB) complexes. Anqa1 ChIP-seq identified sequence motif that shared similarity with CHR element. Tetrahymena contains at least 14 Lin54-like genes, which were named as Anqa1-14 after the ‘ANQA’ mythological creature thought to appear once in ages (Nabeel-Shah et al. 2021).

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00766460(coding)
ATGCAAAGTTCATAAGGTAGAAATTTTATAAGCAAAAATCCAATAGGAGAAGATTTTTTA
TAGCAATTGTAGTTAGATAATCTGCCATAGCAGTTGCTTGAAAAATAAAGGGTTTAAAAT
TAATAATAGTAGTATTAGCAGAATAGCGGTTCTTTAGTTAATAGCAATTTTAGCTCCCAA
TAATAAAAACCTGGTTATACATCGAAAAAGTGTAATTGTAAACAGTCTTAATGCATCAAA
TTGTATTGTGAATGTTATGCTGCTGGAGTTTATTGTAATGGATGCCATTGTGTTAGCTGC
AAGAATAATGATTAATCAGAAGGATGGCGTAATTAAGCAATATAAAATACTCTCGTAAAG
AATCCTACAGCCTTTCTACCTAAAATTAGTTAAAAGCAAGAGACCGCATCAAAAGTTGTT
GATCCTTTAAATTTAGGCAAACATAACAAAGGTTGTGCATGCAAACGTAGTGGCTGTATG
AAAAAGTATTGTGAGTGTTTTTAAGCTGGAGTACCTTGCTCTGAAAATTGCAAATGCACT
GACTGCTAAAATACAGGATTTGTTTCTCATGGAAATTTGCTAAGATAATTTAGAGATGAT
GATTCCTACAATTCTTAAAATTAGATTTTACATAAATTTTTATTAGCCCATAATGAAGAA
CATCTAACCAGTATTTTAGGTGAGAATAATGGAGGAGGAGAATTAGGATTCTATAAAAAG
GGAATACCAATAAAAACTGAATTTATTGAGGAATCTTGCATGAAATTACTATAAATATTA
CACTTACCAGATGAAGATATTTTTAGGCGTAGGGATTAATTAATATTGGAAAAATTCAAT
AAAAATCTTAATCATTCCAATTTAAAAGAAGAGTCTTAAATGGAAAACATCACTTCTTTG
AAAAAAGAAGATAGAATTCTCAAAACTCCTCCATAAAAATCTAAGAGACCAGAAGGGACT
ATGGGAGAAGAAGAGGGATAAAAGAGTGGAGACCACTATAATAAAGATACAAGCTGCGAT
ATTGATTTAGCATGTTAAGATGAAAATATGGATGAAGAAGAAGATATAGTATAGAACAAA
TAAAATCATCTTCATAAAGAAGATGAGGGTGATAATAGTTTAGTTAAAGTTCAAAATGAG
ACATTGCTCAAGGATAGTGAACTTTCATCAATAAATAAGGATAATAATGAATCATAGACA
GAGTCAACAGCTGTAACGTCGTCTATAAATAAATCAAAAAGCTTCTCTTAAAAATCCGAT
TCTAATAACATTTAAAATCTAAATTAAGACAGATAAAAAGAAGGAGATAAGATTAATAGT
GAGGAGCAAGAAGGTTAAATGAAAATAGAAGAAGAAAAGAAAGAAATGATTGAAGAAGAA
GAATAAAAATAGAAAGACAATCTTAATAACGACAAAAACTCAGAAAAGGAAAAATTGTAA
ATAGAATCAGAAGAATAATACGAACAAGAACTTTTGAAACAAAAAAATGGAATTTCCAAT
TAAGAAAGCAGTGGAAATGAAATGGAAATCGAATGCCATTCTTCAGCTTTAAAAAGAAAA
TAGGAGCTCTATGAGATCAGAAGGTCTTTTATTCTGGAAACTTTTATCGATTTACTTAGA
CATGTTGAATAAACTATTTGA


>TTHERM_00766460(protein)
MQSSQGRNFISKNPIGEDFLQQLQLDNLPQQLLEKQRVQNQQQQYQQNSGSLVNSNFSSQ
QQKPGYTSKKCNCKQSQCIKLYCECYAAGVYCNGCHCVSCKNNDQSEGWRNQAIQNTLVK
NPTAFLPKISQKQETASKVVDPLNLGKHNKGCACKRSGCMKKYCECFQAGVPCSENCKCT
DCQNTGFVSHGNLLRQFRDDDSYNSQNQILHKFLLAHNEEHLTSILGENNGGGELGFYKK
GIPIKTEFIEESCMKLLQILHLPDEDIFRRRDQLILEKFNKNLNHSNLKEESQMENITSL
KKEDRILKTPPQKSKRPEGTMGEEEGQKSGDHYNKDTSCDIDLACQDENMDEEEDIVQNK
QNHLHKEDEGDNSLVKVQNETLLKDSELSSINKDNNESQTESTAVTSSINKSKSFSQKSD
SNNIQNLNQDRQKEGDKINSEEQEGQMKIEEEKKEMIEEEEQKQKDNLNNDKNSEKEKLQ
IESEEQYEQELLKQKNGISNQESSGNEMEIECHSSALKRKQELYEIRRSFILETFIDLLR
HVEQTI


>TTHERM_00766460(gene)
ATGCAAAGTTCATAAGGTAGAAATTTTATAAGCAAAAATCCAAGTATAAAATTTAATTAT
TATTAGTTATACCATTTTGTAAATGAGCAACCTTTTTTGATTGAACAAAAGATATTTTTA
CTAACTTATCCTATTTGGTATGATCCATTTCTTATAAATTATACTTTTATAAATAAATAG
TAGGAGAAGATTTTTTATAGCAATTGTAGTTAGATAATCTGCCATAGCAGTTGCTTGAAA
AATAAAGGGTTTAAAATTAATAATAGTAGTATTAGCAGAATAGCGGTTCTTTAGTTAATA
GCAATTTTAGCTCCCAATAATAAAAACCTGGTTATACATCGAAAAAGTGTAATTGTAAAC
AGTCTTAATGCATCAAATTGTATTGTGAATGTTATGCTGCTGGAGTTTATTGTAATGGAT
GCCATTGTGTTAGCTGCAAGAATAATGATTAATCAGAAGTAAAATAAATTCATTTTGCCA
TTTTTACAAATAGATGATAGTCTAACTTATAAAATTTTTTAAAATCAAAATAAATGAGAA
TATTTGATTAAAATTAATTTTGAATAATCTCAAAAGGGATGGCGTAATTAAGCAATATAA
AATACTCTCGTAAAGAATCCTACAGCCTTTCTACCTAAAATTAGTTAAAAGCAAGAGACC
GCATCAAAAGTTGTTGATCCTTTAAATTTAGGCAAACATAACAAAGTAAAAAGAATTCAT
AATTATTAAAATTCATTTCATTTATATAAGAAATACTAAACATTTTAAATAGAAGGAATA
AAATCTTTTCAATAAAATAATAAAACATGCTTTTATAAGTTTTATTTTTATTTAAGTGAA
TCAAATATGATTAATTTAAGTTGATTTAGGTTTATTGCAGAAGTATTAAAAATAGATTTT
TTAGTCAATAACACAATTTATGACATGCATATTGAAGATATTTTTTATCAAATCATTCAA
CTTTTTAAAATTTTAACAAATTTCCGCAAGATTACAAATCCTAAATTTTTTTGAATTCTT
AATTTGTTTTCTTTAACAATTAAATTTAAATTTTATTTAACCTATATTCAAACAAACAAG
ACAAGGAGTCAATGATGTCTTCATTTATACTTTTCAACTTTATATTTTAATTTACTCTTT
TCGAAAATATTTAGGGTTGTGCATGCAAACGTAGTGGCTGTATGAAAAAGTATTGTGAGT
GTTTTTAAGCTGGAGTACCTTGCTCTGAAAATTGCAAATGCACTGACTGGTATGATTTAT
TTAAGAATAAACACTCTTTTAAATATTTTTTTTGTTAAATTTATTTATTTAAAAGATTTT
TTAAACAGTTTCATTAATTATTTTAAAAATAAAGCTAAAATACAGGATTTGTTTCTCATG
GAAATTTGCTAAGATAATTTAGAGATGATGATTCCTACAATTCTTAAAATTAGATTTTAC
GTAAAAAAATATTATTTTAAGATAAATGCAAAATAAAATTTTATGAATTTATTTTATTAA
AATGTAGATAAATTTTTATTAGCCCATAATGAAGAACATCTAACCAGTATTTTAGGTGAG
AATAATGGAGGAGGAGAATTAGGATTCTATAAAAAGGGAATACCAATAAAAACTGAATTT
ATTGAGGAATCTTGCATGAAATTACTATAAATATTACACTTACCAGATGAAGATATTTTT
AGGCGTAGGGATTAATTAATATTGGAAAAATTCAATAAAAATCTTAATCATTCCAATTTA
AAAGAAGAGTCTTAAATGGAAAACATCACTTCTTTGAAAAAAGAAGATAGAATTCTCAAA
ACTCCTCCATAAAAATCTAAGAGACCAGAAGGGACTATGGGAGAAGAAGAGGGATAAAAG
AGTGGAGACCACTATAATAAAGATACAAGCTGCGATATTGATTTAGCATGTTAAGATGAA
GTATTTATTTAATTTATTTTCAAAAAGATTTAAATATTGAGAATTATTTTTTTATTTTGT
AATTACAAATTTAATTGAATTATTTTTATTTTTTAAAGAATATGGATGAAGAAGAAGATA
TAGTATAGAACAAATAAAATCATCTTCATAAAGAAGATGAGGGTGATAATAGTTTAGTTA
AAGTTCAAAATGAGACATTGCTCAAGGATAGTGAACTTTCATCAATAAATAAGGATAATA
ATGAATCATAGACAGAGTCAACAGCTGTAACGTCGTCTATAAATAAATCAAAAAGCTTCT
CTTAAAAATCCGATTCTAATAACATTTAAAATCTAAATTAAGACAGATAAAAAGAAGGAG
ATAAGATTAATAGTGAGGAGCAAGAAGGTTAAATGAAAATAGAAGAAGAAAAGAAAGAAA
TGATTGAAGAAGAAGAATAAAAATAGAAAGACAATCTTAATAACGACAAAAACTCAGAAA
AGGAAAAATTGTAAATAGAATCAGAAGAATAATACGAACAAGAACTTTTGAAACAAAAAA
ATGGAATTTCCAATTAAGAAAGCAGTGGAAATGAAATGGAAATCGAATGCCATTCTTCAG
CTTTAAAAAGAAAATAGGAGCTCTATGAGATCAGAAGGTCTTTTATTCTGGAAACTTTTA
TCGATTTACTTAGACATGTTGAATAAACTATTTGA