Identifiers and Description

Gene Model Identifier

TTHERM_00766450

Standard Name

None

Aliases

PreTt03338 | 126.m00136 | 3740.m00060

Description

SPRY domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00766450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15948.19.997093137033517e-262SPRY domain-containing protein
(363 aa)
OxytrichaContig1079.0.g189.998074580622396e-81SPRY domain
DictyBaseDDB_G02786710.000000000010004361180063202DDB_G0278671 on chromosome: 3
position 784969 to 786624
WormBaseWBGene000165390.00000019998969434520019locus:trim-9 status:Confirme
d UniProt:B1GRL4 protein_i
d:CCD67096.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00766450(coding)
ATGTCTAACGAAATTGGTTACGATCGCGAAAGATTTGTATAAGTAGATGACTAATTTGAA
TGTTTGATTTGCTCTACAATTGTGCGTGATCCAAAAGAATGTAATGGATGTGGTCATCTT
TATTGTAAAAAATGTATAGAAGACTGGCAATAAAAAAGCAAAGATTGTCCAAACAGATGT
TCTATGGCCTAGCACTCAATTACACCTATTTCAAGAGCTTTATAAAGAATGTATAATAAT
TTAGAAATAAGATGTAAAAATTAAAAATGTAACAAAATTGTTAAACTCTGCGATTTAGAA
AAGCATGAATAAGATTGCTGTAGTCCTAATTGTATAAATTTTGATAATTGCTAAAAAAAA
GTAAATAATTCTTTTAGCCCTAAATAAATCTGCAGCTTGGAATGCGAATTGCATTAAGAA
ATTCTCAAAGCAGTAAAATAAACTGAAGTCTTATAGCTCATTTAAGACTACACAAAAAAA
ATATCATCTAATTCATCCTCTGTACAAGTTTTACCCTCATAAATAATCTAAGTTAATGCA
CCCATTCCTGGTTAAATAAATTCTATTATGTGGAGATGGGACCCACAGTGTGCAGGTACA
GGAATAAGAATTACAAATAATGGTACAAACTGTTTCCTTACAGAATCTGCTTACATGTTC
AGAACAGTCTTGTCTGATACACCAATGACTACAGGTACTTACTATTGGGAAATTCATGCT
GATGATAAGACTGAAAATGAACTTAAAATAGGTGTTAGCAGCAAAAAAGATTTTAACTAC
AATAGTGCTTTTTGTGATTTCGACTATGGTTGGGCTTATTATGGACTAGGACAATTAAGA
CATGGATCTAATGCATCTGGTCCTTAATATGGAAAAAGATTTAAAAAGGAAGGTGTCCTT
GGTATTTATTTGAATATGAATAAAGGTACTCTCAGCTTTGCTCTTAACGGAGAATTCTTT
GGAGTTGCTTATACAAATGATGCCTTAAAAAAAGGTCCTATTTATGCTGCAGTATCTCTT
CTCCATCAAGCAGGTTGCACTATAAAATCAGGAATTCAAACTCCAAAGTATTTCTTAAAC
TGTTGA


>TTHERM_00766450(protein)
MSNEIGYDRERFVQVDDQFECLICSTIVRDPKECNGCGHLYCKKCIEDWQQKSKDCPNRC
SMAQHSITPISRALQRMYNNLEIRCKNQKCNKIVKLCDLEKHEQDCCSPNCINFDNCQKK
VNNSFSPKQICSLECELHQEILKAVKQTEVLQLIQDYTKKISSNSSSVQVLPSQIIQVNA
PIPGQINSIMWRWDPQCAGTGIRITNNGTNCFLTESAYMFRTVLSDTPMTTGTYYWEIHA
DDKTENELKIGVSSKKDFNYNSAFCDFDYGWAYYGLGQLRHGSNASGPQYGKRFKKEGVL
GIYLNMNKGTLSFALNGEFFGVAYTNDALKKGPIYAAVSLLHQAGCTIKSGIQTPKYFLN
C


>TTHERM_00766450(gene)
ATGTCTAACGAAATTGGTTACGATCGCGAAAGATTTGTATAAGTAGATGACTAATTTGAA
TGTTTGATTTGCTCTACAATTGTGCGTGATCCAAAAGAATGTAATGGATGTGGTCATCTT
TATTGTAAAAAATGTATAGAAGACTGGCAATAAAAAAGCAAGTAAATTTCATCAATAATT
TTTAAAAATTAAAAGAAAAACACAATTTGGTATTAAAAAATAAACCAAATTTTATCATTA
ATCAAATTTTTTCAATAGACAAAAGATTCAAAAGTCTCTCGGGGAAAAAATCATTTTAAT
TTTTTATTAAAACCCTTTATTTATTTTTTAAAAATATTTAAAAAAATTAATAGAGATTGT
CCAAACAGATGTTCTATGGCCTAGCACTCAATTACACCTATTTCAAGAGCTTTATAAAGA
ATGTATAATAATTTAGAAATAAGATGTAAAAATTAAAAATGTAACAAAATTGTTAAACTC
TGCGATTTAGAAAAGCATGAATAAGATTGCTGTAGTCCTAATTGTATAAATTTTGATAAT
TGCTAAAAAAAAGTAAATAATTCTTTTAGCCCTAAATAAATCTGCAGCTTGGAATGCGAA
TTGCATTAAGAAATTCTCAAAGCAGTAAAATAAACTGAAGTCTTATAGCTCATTTAAGAC
TACACAAAAAAAATATCATCTAATTCATCCTCTGTACAAGTTTTACCCTCATAAATAATC
TAAGTTAATGCACCCATTCCTGGTTAAATAAATTCTATTATGTGGAGATGGGACCCACAG
TGTGCAGGTACAGGAATAAGAATTACAAATAATGGTACAAACTGTTTCCTTACAGAATCT
GCTTACATGTTCAGAACAGTCTTGTCTGATACAGTAAAAAAAAATTAATTTAAAAAATGA
TTCCTTTTATAATAATTAGTTAAAAATGAGTATATAAAAATTGAGATAAATACTTTTAAA
GAAATTTTTTTATTCTAAAGAATTTTTAGATTGAAAAAGAATTAATAATTCTAAAGATTA
ATTTCTAAGAAAAGTTTAATTAATAACCTAAAGAATTAACAAATTAATTTATTTATTCTA
TCTAGATTATTAAAAAAGCTTAATGATTTGAAATTGCAAATTTTTTTGGAATTTACTTTC
AAATAATTAATAATTATTTTTATATTATAAATAGCCAATGACTACAGGTACTTACTATTG
GGAAATTCATGCTGATGATAAGACTGAAAATGAACTTAAAATAGGTGTTAGCAGCAAAAA
AGATTTTAACTACAATAGTGCTTTTTGTGATTTCGACTATGGTTGGGCTTATTATGGACT
AGGACAATTAAGACATGGATCTAATGCATCTGGTCCTTAATATGGAAAAAGATTTAAAAA
GGAAGGTGTCCTTGGTATTTATTTGAATATGAATAAAGGTACTCTCAGCTTTGCTCTTAA
CGGAGAATTCTTTGGAGTTGCTTATACAAATGATGCCTTAAAAAAAGGTCCTATTTATGC
TGCAGTATCTCTTCTCCATCAAGCAGGTTGCACTATAAAATCAGGAATTCAAACTCCAAG
TAATTACTTAATTTATTAATTAATCTTTTTAATTTCAATAATATTTTTTTCAATGAAATA
TAAAATCTTAAACATTTTTTTTTTTATCAAATAATTAGAGTATTTCTTAAACTGTTGA