Identifiers and Description

Gene Model Identifier

TTHERM_00735270

Standard Name

None

Aliases

PreTt25451 | 120.m00109

Description

cwf18 pre-mRNA splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00272 ) Cecropin family
  • ( PF08315 ) cwf18 pre-mRNA splicing factor
  • ( TIGR01766 ) transposase, IS605 OrfB family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.8%

TetraMine Data

TTHERM_00735270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10626.16.002009875581486e-101hypothetical protein (198 aa)
OxytrichaContig415.1.g1040.0000004998288985444982cwf18 pre-mRNA splicing factor
DictyBaseDDB_G02926480.000005000363240844623DDB_G0292648 on chromosome: 6
position 1901580 to 1902678
WormBaseWBGene000220920.00020003864201578029status:Confirmed UniProt:Q95
XJ1 protein_id:CCD74125.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00735270(coding)
ATGAATGAATTGACATAAATAAATGCATTGATTAATATATCTGCTAATATTTATTTATTA
ATTGTATTGATTTATATATAATATAAGCAACTATTTATTATAGAAGACAATATATCCTTA
TAAAATATAAATAAATAGCTAGATCTATCTACCCATAGGATTTTACAATTAGAATAAATG
TTTAGCGTACCAAATGCATTCCCTAATAACTTGAGTTCTTCTAGAGAAGATCCAACTCCT
GATCCTCAAGCTCCTTTATAATTTGTAAATTATTACCCAGTGAGTGCTAATTTGTAGCAA
TAAGAACGCAAAGAAAGTCAAATAAAAGAAATCGAATAAGCTGTAGAATCTAAAATTAAG
TTTATAATAAAGAGCTTTTTAGATTAGGAATAGCAACCATTGAATATTATACCTAAAAAG
GGCAACTTAGATTTAAAGAAATTTTTAAACAAGCGTTTAGAGAAGCTGAACAAGCGCACA
GAAAAAGCAATTAATAAATTACTTCGTTAAAAATTCAACGAAGCAAATGGAATAAAAGAA
GAGGAATCAGCAGATGTAAAAGCTGACGCATAAGCCGATAAAAAATAGTAAGAAGTTAAG
TTCAATCCTATGTATAATAGAGATGTTACATATGACAGCGAAATGTATGACGAAGATGAA
ATAGCTGAAAATGAATTTATAAAAGCAGATGGCAATAAGCTCATAGAAGGATTTGCCACA
TAAGAAAAAATATATTAAAAATTAGACGACAGTGACTCTGATTGA


>TTHERM_00735270(protein)
MNELTQINALINISANIYLLIVLIYIQYKQLFIIEDNISLQNINKQLDLSTHRILQLEQM
FSVPNAFPNNLSSSREDPTPDPQAPLQFVNYYPVSANLQQQERKESQIKEIEQAVESKIK
FIIKSFLDQEQQPLNIIPKKGNLDLKKFLNKRLEKLNKRTEKAINKLLRQKFNEANGIKE
EESADVKADAQADKKQQEVKFNPMYNRDVTYDSEMYDEDEIAENEFIKADGNKLIEGFAT
QEKIYQKLDDSDSD


>TTHERM_00735270(gene)
ATGAATGAATTGACATAAATAAATGCATTGATTAATATATCTGCTAATATTTATTTATTA
ATTGTATTGATTTATATATAATATAAGCAACTATTTATTATAGAAGACAATATATCCTTA
TAAAATATAAATAAATAGCTAGATCTATCTACCCATAGGATTTTACAATTAGAATAAATG
TTTAGCGTACCAAATGCATTCCCTAATAACTTGAGTTCTTCTAGAGAAGATCCAACTCCT
GATCCTCAAGCTCCTTTATAATTTGTAAATTATTACCCAGTGAGTGCTAATTTGTAGCAA
TAAGAACGCAAAGAAAGTCAAATAAAAGAAATCGAATAAGCTGTAGAATCTAAAATTAAG
TTTATAATAAAGAGCTTTTTAGATTAGGAATAGCAACCATTGAATATTATACCTAAAAAG
GGCAACTTAGATTTAAAGAAATTTTTAAACAAGCGTTTAGAGAAGCTGAACAAGCGCACA
GAAAAAGCAATTAATAAATTACTTCGTAAATACCTCAATTTAACACATATAAATTGAAAT
AATATGACAAATAATTTTAAGAAAATATCTAAATTATTGTTTAAAAATAACTCAAAGGTT
AAAAATTCAACGAAGCAAATGGAATAAAAGAAGAGGAATCAGCAGATGTAAAAGCTGACG
CATAAGCCGATAAAAAATAGTAAGAAGTTAAGTTCAATCCTATGTATAATAGAGATGTTA
CATATGACAGCGAAATGTATGACGAAGATGAAATAGCTGAAAATGAATTTATAAAAGCAG
ATGGCAATAAGCTCATAGAAGGATTTGCCACATAAGAAAAAATATATTAAGTAAACTATC
TATCAATCATATTTATTTTAAAAACAGCAAATAAATTTATTTTGGAAAAATACCTAATTT
ATCATATTAAAAGGGATGTGTTTTATATAATTTATAATTTTTTAAAGCTAACAAATTCTA
TTTCAAATTTAATAATTAAGTTAACTTTTTTAATATTTTCTTTGTTTTAAACAAACAGAA
ATTAGACGACAGTGACTCTGATTGA