Identifiers and Description

Gene Model Identifier

TTHERM_00727660

Standard Name

None

Aliases

PreTt07267 | 118.m00095 | 3739.m00018

Description

methyltransferase-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01170 ) Putative RNA methylase family UPF0020

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_00727660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17921.14.001580524003507e-155hypothetical protein (246 aa)
OxytrichaContig18370.0.g851.0000633497921574e-36Methyltransferase domain
WormBaseWBGene000080082.0002795641672355e-21status:Confirmed UniProt:Q18
511 protein_id:CAA86320.1
Stentor CoeruleusSteCoe_334970.00000000000003442477108469977
DictyBaseDDB_G02894450.0007999190683310628prmt2 on chromosome: 5 positio
n 2803733 to 2805584

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00727660(coding)
ATGTAAGGAAAAGGAGGCAAATAAGTTAAACTTAAACATATTGAGTCTTTCTTATCAGAC
TTAGATAACTTCGAATAAGGAGAGTTTAGCAAGTTAAAATTAGAGTAGCATATGACTCCA
GCAAATGTAGCAGCACTATGTGTCTCCATGGTTGCAGAAATTGAGGAAAATTTGGAAGAT
TAAATAGTTGGAGATTTTGGATGCGGTACAGGAATGTTATCTTGTGGTATGCTCTGTGTT
GGTGCAGGGCAAGTTATTGGCTTGGAATTAGACTCTAAGTATGCGTAAATTACTTTGGAT
ACTTTGGAAGACAAATTCGAAGATCCTAGCATGTATGATATTATAAATATCAACGTTAAA
CATTGGTAACCTCCAACATTGAATGGAAAATTATTTGATACTGTTGTTATGAATCCTCCA
TTTGGAACAAAAGATGAAGGAATAGATGTCGTTTTTCTTGAAAAAGCATTTTAAACATGC
TCAGGAAATGTATATTCTATGCATAAATCATCAACAAGAAAATTCTTGTAAAAGAAAGCT
GAATAGTGTGGTTATGAATTTACAGTTCTTTAAGAAATAAAGTTTCCTCTTCCAAAGAGA
TTTAATAAATATCACAAAAAAGAAGTAGCATACACTGAGGTAGATTTTATATTATTTAAA
CCTAAGAAAATGATTCCTTAAATAAAATAATAACAAAATGAAGAGAAAAAAGTTAATATT
TAAGAATGA


>TTHERM_00727660(protein)
MQGKGGKQVKLKHIESFLSDLDNFEQGEFSKLKLEQHMTPANVAALCVSMVAEIEENLED
QIVGDFGCGTGMLSCGMLCVGAGQVIGLELDSKYAQITLDTLEDKFEDPSMYDIININVK
HWQPPTLNGKLFDTVVMNPPFGTKDEGIDVVFLEKAFQTCSGNVYSMHKSSTRKFLQKKA
EQCGYEFTVLQEIKFPLPKRFNKYHKKEVAYTEVDFILFKPKKMIPQIKQQQNEEKKVNI
QE


>TTHERM_00727660(gene)
ATGTAAGGAAAAGGAGGCAAATAAGTTAAACTTAAACATATTGAGTCTTTCTTATCAGAC
TTAGATAACTTCGAATAAGGAGAGTTTAGCAAGTTAAAATTAGAGTAGCATATGACTCCA
GCAAATGTAGCAGCACTATGTGTCTCCATGGTTGCAGAAGTAGGATTTTAGTTTTTTTAT
TGGGATAGAATATGGTTTAAACTTGTTATTAAAATGCATATTCAATCGTAATGTAAAAAA
TAATCATGTTTGAAATATACTAATAGATTGAGGAAAATTTGGAAGATTAAATAGTTGGAG
ATTTTGGATGCGGTACAGGAATGTTATCTTGTGGTATGCTCTGTGTTGGTGCAGGGTATA
AATTTATAGATTAAACATATTTCTTAAAATTCAACTTAATTATGAAGATGGAGATTTTAA
TTAAATAAGATAAATGATATCTTTTTAAGTTAAATTTTAAAACGTTTATTATAAGTTAGG
CAAGTTATTGGCTTGGAATTAGACTCTAAGTATGCGTAAATTACTTTGGATACTTTGGAA
GACAAATTCGAAGATCCTAGCATGTATGATATTATAAATATCAACGTTAAACATTGGTAA
CCTCCAACATTGAATGGAAAATTATTTGATACTGTTGTTATGAATCCTCCATTTGGAACA
AAAGATGAAGGAATAGATGTCGTTTTTCTTGAAAAAGCATTTTGTAAATTTAATTTAAGA
ATTAAAAAAATATATTTCTAATTTAATAAAAGAAACATGCTCAGGAAATGTATATTCTAT
GCATAAATCATCAACAAGAAAAGTAAAATTTTTAAATAAAAGAAATAGGAATAGATTAAA
TTATAATAAATATACTTTAAAATAAAGTTCTTGTAAAAGAAAGCTGAATAGTGTGGTTAT
GAATTTACAGTTCTTTAAGAAATAAAGTTTCCTCTTCCAAAGAGATTTAATAAATATCAC
AAAAAAGGTAATATCATAAAACATTTTCTTTGTTTTTAATATCTTTCATTAAATTTTAAT
AGAAGTAGCATACACTGAGGTAGATTTTATATTATTTAAACCTAAGAAAATGATTCCTTA
AATAAAATAATAACAAAATGAAGAGAAAAAAGTTAATATTTAAGAATGA