Identifiers and Description

Gene Model Identifier

TTHERM_00726120

Standard Name

None

Aliases

PreTt21878 | 117.m00130

Description

dimethyladenosine transferase putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00537 ) methylase, putative
  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( TIGR00755 ) dimethyladenosine transferase
  • ( TIGR02072 ) biotin biosynthesis protein BioC
  • ( PF00398 ) ribosomal RNA adenine dimethylase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00726120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04604.19.997093137033517e-262hypothetical protein (1873 aa)
OxytrichaContig22762.0.g473.00004133315474e-119Ribosomal RNA adenine dimethyl
ase
DictyBaseDDB_G02837892.999977985165137e-107dimt1l on chromosome: 4 positi
on 1107655 to 1109115
SGDYPL266W5.001208010698328e-102DIM1 Essential 18S rRNA dimeth
ylase (dimethyladenosine trans
ferase), responsible for conse
rved m6(2)Am6(2)A dimethylatio
n in 3-terminal loop of 18S rR
NA, part of 90S and 40S pre-pa
rticles in nucleolus, involved
in pre-ribosomal RNA processi
ng
WormBaseWBGene000084555.999967307255342e-97Probable dimethyladenosine tra
nsferase status:Confirmed
UniProt:Q09522 protein_id:CA
A87382.2
Stentor CoeruleusSteCoe_251457.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00726120(coding)
ATGAGCAAAAACCCTGTTGCCAAAAACCAAATGGTTTTTAATAAATCTTTTGGTTAGCAT
ATTTTAGTTAATCCATAAATGTTACATAGTATAGTAGAAAAATCTGCTATTAGACCTACT
GATATTGTATTAGAAATTGGTCCTGGTACTGGTAATCTTACTGCACTCCTCTTAGAAAAG
GCTAAAAAAGTTATTGCTGTTGAAATTGATCCTCGAATGGTTGCTGAACTAAACAAAAGA
TTCAAATATTCTCAACATGCACATAAATTCGAACTTATTTAAGGAGATGCTATTTCAACA
GAGTTCCCATTTTTTGATGTTTGTGTTGCAAATACTCCTTATTAAATTTCATCACCTCTC
GTATTCAAGCTCCTCTCTCATAGACCTCTTTTTAGACATGCAGTTCTTATGTTTTAAAAA
GAATTCGCAATGAGATGTGTAGCAAAGCCATCAAGTGATTTATATTGTAGATTATCTGTA
AACGTTTAGTTGTTATCAAAGTGTGATCACTTAATCAAGGTAGGTAAAAATAACTTCAAG
CCACCACCAAAAGTTGAATCTTCTGTTATTCGTATTGAACCAAAGAACCCTGCTCCTGTA
CTTAACTACATTGAATGGGATGGTCTTCTTAGAGTTTGCTTTATGAGAAAGAATAAATAG
CTTTCTGCTATCTTTAAGAATAAGTCAGTACTCTAAGTTTTAGAGAAGAACTTTGAAACA
TATTAAAAGATAAAAGCTATAGAATAGGGTGCAGTTGAAGAAGAATAAAAGCAAAATTAA
GATACAAAAGGGAAAAAAGGAAATAATAATAATAATAATGTTGCAGATTTAATGTAAATG
GGAATGGATGAAGAGTTAGATGAAGAAATAGATGATGAAAAAAGCAACAAAAAATAAAAT
AAAAAAAAGCATAACGATGATGAAGGATTAGATGAAGAAGAAGATGCAGCTTAAGTAGAT
GATAAAAAAAAATTATTTAAAGAAAAAATACATAAAATACTTGAGGACAGTGGATATCTT
GAAAAAAGACCAGCAAAATTAGATATTGATGATTATTTGAAATTATTATTCGTATTTAAT
CAAAATGAAATTCACTTTAAGTGA


>TTHERM_00726120(protein)
MSKNPVAKNQMVFNKSFGQHILVNPQMLHSIVEKSAIRPTDIVLEIGPGTGNLTALLLEK
AKKVIAVEIDPRMVAELNKRFKYSQHAHKFELIQGDAISTEFPFFDVCVANTPYQISSPL
VFKLLSHRPLFRHAVLMFQKEFAMRCVAKPSSDLYCRLSVNVQLLSKCDHLIKVGKNNFK
PPPKVESSVIRIEPKNPAPVLNYIEWDGLLRVCFMRKNKQLSAIFKNKSVLQVLEKNFET
YQKIKAIEQGAVEEEQKQNQDTKGKKGNNNNNNVADLMQMGMDEELDEEIDDEKSNKKQN
KKKHNDDEGLDEEEDAAQVDDKKKLFKEKIHKILEDSGYLEKRPAKLDIDDYLKLLFVFN
QNEIHFK


>TTHERM_00726120(gene)
ATGAGCAAAAACCCTGTTGCCAAAAACCAAATGGTTTTTAATAAAGTATGTTAATTATTT
TACTAATATAGATAAAATCATTAAAAAGAATATAATTTAGGTTAAAATATTTTATTTTTA
TTGAATAAAACAGTCTTTTGGTTAGCATATTTTAGTTAATCCATAAATGTTACATAGTAT
AGTAGAAAAATCTGCTATTAGACCTACTGATATTGTATTAGAAATTGGTCCTGGTACTGG
TAATCTTACTGCACTCCTCTTAGAAAAGGCTAAAAAAGTTATTGCTGTTGAAATTGATCC
TCGAATGGTTGCTGAACTAAACAAAAGATTCAAATATTCTCAACATGCACATAAATTCGA
ACTTATTTAAGGAGATGCTATTTCAACAGAGTTCCCATTTTTTGATGTTTGTGTTGCAAA
TACTCCTTATTAAATTTCATCACCTCTCGTATTCAAGCTCCTCTCTCATAGACCTCTTTT
TAGACATGCAGTTCTTATGTTTTAGTAAAATTTTGAATCATAATCTTATTCTTAGATACA
ATTATTATATACATATGCTAATGTTAAATTTAAAATTAATCTAAATTTACTACTATTAGA
AAAGAATTCGCAATGAGATGTGTAGCAAAGCCATCAAGTGATTTATATTGTAGATTATCT
GTAAACGTTTAGTTGTTATCAAAGTGTGATCACTTAATCAAGGTAGGTAAAAATAACTTC
AAGCCACCACCAAAAGTTGAATCTTCTGTTATTCGTATTGAACCAAAGAACCCTGCTCCT
GTACTTAACTACATTGGTAAATAGCAAAATTATTTTATATGATCAAATAAATAATTTTTT
TTAAAATATTAATAGAATGGGATGGTCTTCTTAGAGTTTGCTTTATGAGAAAGAATAAAT
AGCTTTCTGCTATCTTTAAGAATAAGTCAGTACTCTAAGTTTTAGAGAAGAACTTTGAAA
CATATTAAAAGATAAAAGCTATAGAATAGGGTGCAGTTGAAGAAGAATAAAAGCAAAATT
AAGATACAAAAGGGAAAAAAGGAAATAATAATAATAATAATGTTGCAGATTTAATGTAAA
TGGGAATGGATGAAGAGTTAGATGAAGAAATAGATGATGAAAAAAGCAACAAAAAATAAA
ATAAAAAAAAGCATAACGATGATGAAGGATTAGATGAAGAAGAAGATGCAGCTTAAGTAG
ATGATAAAAAAAAATTATTTAAAGAAAAAATACATAAAATACTTGAGGACAGTGGATATC
TTGAAAAAAGACCAGCAAAATTAGATATTGATGATTATTTGAAATTATTATTCGTATTTA
ATCAAAATGAAATTCACTTTAAGTGA