Identifiers and Description

Gene Model Identifier

TTHERM_00723550

Standard Name

None

Aliases

PreTt18115 | 116.m00140 | 3671.m00064

Description

tRNA-dihydrouridine synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01207 ) Dihydrouridine synthase (Dus)
  • ( PF00977 ) Histidine biosynthesis protein
  • ( TIGR00742 ) tRNA dihydrouridine synthase A
  • ( TIGR01919 ) bifunctional HisA/TrpF protein
  • ( TIGR00737 ) putative TIM-barrel protein, nifR3 family
  • ( TIGR01037 ) dihydroorotate dehydrogenase family protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00723550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14829.19.997093137033517e-262dihydrouridine synthase (457 a
a)
OxytrichaContig5250.0.g191.0004771100126706e-129Dihydrouridine synthase (Dus)
DictyBaseDDB_G02788033.0004885828297914e-109dus1l on chromosome: 3 positio
n 1208252 to 1209559
SGDYML080W2.9986068920536807e-84DUS1 Dihydrouridine synthase,
member of a widespread family
of conserved proteins includin
g Smm1p, Dus3p, and Dus4p; mod
ifies pre-tRNA(Phe) at U17
WormBaseWBGene000094526.997568408582301e-83status:Confirmed UniProt:Q9X
VN8 protein_id:CAB03067.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00723550(coding)
ATGGATATTTAAAATACACAAATCGAATAGGAAATATAAGATAAGGAATAGACCTTATTA
GAAAATCCTGAAAAAGAATAAACCATTTCTAGTGAAAGTATTAAATGTGGGAAATTTTAG
GAATTAAGAGTTTAAAAGCCTATTCCAATTTCAAATAACTTAAGCAAAGGACCTAAACTT
CATGGATATAATTTTTACAAAAGCTTAGGTTCTCCTTAGTATGTATGCGCACCAATGGTA
GATCAATCAGAATTAGCATTCCGTATGCTTTGCAGAAAGTATGGAACCACATTAGCATAC
ACTCCTATGATTCATAGCAAGGTTCTTTAAGATTAAGGTTATGGATATTTGAATTCTGTA
TTTAGCACTTGTCAAGAAGATAGACCTTTATTTGCATAGTTTTGTGGTAACAACCCAGAC
GCTCTTCTTGCAGGAGCTAGATATGTTGAAGATAAATGTGATGCTATTGATATCAATTTC
GGATGCCCTTAAGGTATTGCAAAAAGAGGAAGATATGGTTCATATCTTTTAAGTGAACCT
GACACCATAGTAGCATTAGTGAAAAAATTACATGAAAATCTTAGTATTCCAGTCACTTGC
AAAATACGTATTCTCCCTAATCGCTAACAAACAATTGAGTTAGCTAAAAAAATTGAAGCT
GCAGGCTGTTCAATTTTAACTGTCCATGGACGTACTAAAGAGTAGAATAAAGATACTGTA
GGATTATGCGATTGGGATATAATAAAAATTATAAAAGAAGAATTAAGCATTCCAGTCTTT
GCTAATGGAGGTATATATACTTATGAAGATGTGTAAAAGTGTTTAGAATATACTGGAGTA
GATGGAGTTATGAGCGCAGAAAGTCTGTTGGAAAATCCAGCTTTGTTTAGTGGTCAAATA
TATGATTTAGATGAGATTGCTTTAGAATATCTTGAATTTGCAGAAAAATACCCAACTCCT
CATTTCTTCTCAAAAGGTCATATCTTTAAATTCTTGCATTAAGGACTTCAAGTTCATACT
GACCTCAGAACCAAACTCGCAAATGTAAAAACTATAGAAGAACAAAAAGAAATAGCACTT
GAAATGAAAAAGAGACGTGAACACATGTCAAAAGAAGAAAAATTCGGATGGTATACTAGG
TATTGGGATAAAATGGGTGTTGATAAACAAAAATACAACTAGGGATGTGAAAATTGGTAA
GAAGCATACTAAAATATATAGACATGCTGCGAATCTAGCAAAAACAACTAGACTCTATAA
ACTGAATAATAAAATCATGAAAAATAAATTCAAAATTCTGAATAAAAATCAGAAAATTAA
GTTTAAGAATAATGA


>TTHERM_00723550(protein)
MDIQNTQIEQEIQDKEQTLLENPEKEQTISSESIKCGKFQELRVQKPIPISNNLSKGPKL
HGYNFYKSLGSPQYVCAPMVDQSELAFRMLCRKYGTTLAYTPMIHSKVLQDQGYGYLNSV
FSTCQEDRPLFAQFCGNNPDALLAGARYVEDKCDAIDINFGCPQGIAKRGRYGSYLLSEP
DTIVALVKKLHENLSIPVTCKIRILPNRQQTIELAKKIEAAGCSILTVHGRTKEQNKDTV
GLCDWDIIKIIKEELSIPVFANGGIYTYEDVQKCLEYTGVDGVMSAESLLENPALFSGQI
YDLDEIALEYLEFAEKYPTPHFFSKGHIFKFLHQGLQVHTDLRTKLANVKTIEEQKEIAL
EMKKRREHMSKEEKFGWYTRYWDKMGVDKQKYNQGCENWQEAYQNIQTCCESSKNNQTLQ
TEQQNHEKQIQNSEQKSENQVQEQ


>TTHERM_00723550(gene)
ATGGATATTTAAAATACACAAATCGAATAGGAAATATAAGATAAGGAATAGACCTTATTA
GAAAATCCTGAAAAAGAATAAACCATTTCTAGTGAAAGTATTAAATGTGGGAAATTTTAG
GAATTAAGAGTTTAAAAGCCTATTCCAATTTCAAATAACTTAAGCAAAGGACCTAAACTT
CATGGATATAATTTTTACAAAAGCTTAGGTTCTCCTTAGTATGTATGCGCACCAATGGTA
GATCAATCAGAATTAGCATTCCGTATGCTTTGCAGAAAGTATGGAACCACATTAGCATAC
ACTCCTATGATTCATAGCAAGGTTCTTTAAGATTAAGGTTATGGATATTTGAATTCTGTA
TTTAGCACTTGTCAAGAAGATAGACCTTTATTTGCATAGTTTTGTGGTAACAACCCAGAC
GCTCTTCTTGCAGGAGCTAGATATGTTGAAGATAAATGTGATGCTATTGATATCAATTTC
GGATGCCCTTAAGGTATTGCAAAAAGAGGAAGATATGGTTCATATCTTTTAAGTGAACCT
GACACCATAGTAGCATTAGTGAAAAAATTACATGAAAATCTTAGTATTCCAGTCACTTGC
AAAATACGTATTCTCCCTAATCGCTAACAAACAGTAATACATTTTTATATTTCATATGCA
ATATTTAATAAACCATATCCTAAGTATCATTTACAAAATTTCTGGTTATTAAACCTATCA
CAAAATAGAGTTTAAACAATATTGTTTACATTTATAAAGTAAAATTAACATAAATTTTTA
TTATTATTAAATAGATTGAGTTAGCTAAAAAAATTGAAGCTGCAGGCTGTTCAATTTTAA
CTGTCCATGGACGTACTAAAGAGTAGAATAAAGATACTGTAGGATTATGCGATTGGGATA
TAATAAAAATTATAAAAGAAGAATTAAGCATTCCAGTCTTTGCTAATGGAGGTATATATA
CTTATGAAGATGTGTAAAAGTGTTTAGAATATACTGGAGTAGATGGAGTTATGAGCGCAG
AAAGTCTGTTGGAAAATCCAGCTTTGTTTAGTGGTCAAATATATGATTTAGATGAGATTG
CTTTAGAATATCTTGAATTTGCAGAAAAATACCCAACTCCTCATTTCTTCTCAAAAGGTC
ATATCTTTAAATTCTTGCATTAAGGACTTCAAGTTCATACTGACCTCAGAACCAAACTCG
CAAATGTAAAAACTATAGAAGAACAAAAAGAAATAGCACTTGAAATGAAAAAGAGACGTG
AACACATGTCAAAAGAAGAAAAATTCGGATGGTATACTAGGTATTGGGATAAAATGGGTG
TTGATAAACAAAAATACAACTAGGGATGTGAAAATTGGTAAGAAGCATACTAAAATATAT
AGACATGCTGCGAATCTAGCAAAAACAACTAGACTCTATAAACTGAATAATAAAATCATG
AAAAATAAATTCAAAATTCTGAATAAAAATCAGAAAATTAAGTTTAAGAATAATGA