Identifiers and Description

Gene Model Identifier

TTHERM_00721600

Standard Name

None

Aliases

PreTt18468 | 115.m00124

Description

Myb-like DNA-binding domain shaqkyf class protein; myb-like DNA-binding domain- SHAQKYF class family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF05064 ) Nsp1-like C-terminal region
  • ( TIGR01602 ) Plasmodium yoelii repeat of length
  • ( TIGR01557 ) myb-like DNA-binding domain, SHAQKYF class

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00721600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17455.19.997093137033517e-262myb-like DNA-binding domain, s
haqkyf class family protein (9
18 aa)
OxytrichaContig1106.1.g916.000675497867615e-22Myb-like DNA-binding domain
DictyBaseDDB_G02744630.000000000007996637300921877mybJ on chromosome: 2 position
4505147 to 4507593

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00721600(coding)
ATGCTCCCCTAAAATAACCAAATTGATATCGCTTAGATATTAAAAGATTTTTATATTCCT
GAAAACTCTCTCGCTACTAATCGGATACACACAAACAATCTATTTCAAACTGGATTGACT
CAGTAATAGCAGTAAATTATATCATTGCTTAACTGCTAGCAGTAATCATAGTAGTTATAG
AGTCCTTAATCTTAAGAGCTACAAGAAAGACTTAATCTCTACCTTCATTAGTAATAATTG
CAAATCTAACAATAATAAATCTAACTTTCTGATTTAGTAGCTCTCAGTGCTCAATTATCA
GCTGGTAACCCTGCTCTATTTAACAATGCCTTAACTTAATAGAGTACTCCTAATTAAATG
AATATTGAAATCACTTAATAGCCTTAAGGCATCAATCATTTAAATAAGTAAATAAACTTA
CTTACTGAATCTAATCCTATATCAAATGCCTTCAATAATACTGCACAAGCAAACACAATG
AGCAAAACAGCCCAACCATCCTTTAATTACTCTTCTTCTGCTCAAAATATGATCTTTTAA
AATTTATAAAATCAATTAACCACACCAAGCAGTAGAAGTATCATCGAGTCTTTCTCTGAG
CAGAATTCTTAATCTAATATCTCTATTTAAAAATCTAATTTTTCTTAAAACCCTAATAGC
AATGTTAGTGCAAATAATAGCGATAATGCAGCAAATAGCACTATTAATAAAAGTCCTTCA
GCCACTTAAAACTCAGTCAATTAACCAGTAAAATCAATCAATTACAACAATACAATCTAA
AATCCTAATGGATCTAACACAGGGCGTTGGACTAGAGAAGAGCACCTACGCTTTGTAAAG
GGTTTGGGAATGTATGGAAAAAATTGGAAAAAGGTTGAAGAATATGTAGGAACACGTTCA
GGAGCTTAAATTCGTTCTCATGCTTAAAAGTTCTTCAACAAAATCTAAAGAGAAAATGCA
AAAAGTAACTCAAAATCTGGAAATAATGGCAAAAATGGAAATCTACAATCAGAGGATTCC
TTCCCATAAATGAGAAAGAGACAACAAAGCACGCAAAGCAACTATAGCTGTGATTTTGCC
TCAGATGACGGAGAAGGTGAAAATGATTTACAAAATTAAAATTAATTGGAAGAAATTGTC
CCTCAATAAAGTAAATAAAAAGATGCAAAAGAGTGGCTCCATTACTATAAACTATTATAA
CAGACTTGTCAGTAAAACTTAGAAGCCTAAAAGCAAAATAAAAACCTATCAGAGGAGCAA
ATACAGCAATAGGAAGAACAACTTAAAAAAATATAAATATTTATCTAACTTCTATCTGCT
TGCGATAACATCAACTAACATATCGATTGCGCTAGTCCAATGTCATAGGGATCTCCAATG
GCTTCACTCTTACCTTTCTCTTTTGATAATCTCAACATAAATAGCCCTCTTATGAATGCT
TCTCCTGGCTAATAATAAAATTTAAAGCCTTAAGATCCTCATCAAATAGCAGATATTAAT
AGCTTTTCTCTTGATTCAAACTAAGGAGACCATACAAAATTTGGTTAGAATCTATCAAAA
TAAAGCAATTTTGGCCTAAATTCAAAGCAAATGCATTTCGGTTCTTTGTTTAAGAAGTAC
CATGAAGCTAATTCTGATTTTAATGACTAGCAAAGTAATACAAGCTAGAATTCAGTAGAG
AGTAAAATTGAGGGAAAAAATGAAAGCTTTTCCAATAATCCTTGTGGAATTATTTAATCT
AAGCTAAAAATTGATAATCAAACAAAAACTCAAAGAGAAAGTGAAACTTAGATAAGCAAT
CGATAATTATCAAAATCCACTGATATTCAGACTAATAGTAGAGTATCAAAGATATCATCT
AATAGTGTTGAAGAAAGCAATTTATAAGACGGTGAAGATGAAGAAGAAATTTCAGAATAA
GCAACAAACAGGCCAAATAATTTATCAAATTCCGCAATAAGTAGCAATAATGATCAAAAT
TCCACCTTTTCTACACCTGAAAATTAAAAGCTTGCAAATTAAGGAAATGGAAACCAAAAC
AACTCAAATAATTCATAAAATAATTATTTTAATAATTTTTAGTTTGTTGGAGAAAATATT
GATATAGAGTCAGACTTTTCTAAAATAAAAAATCTATCAAATTAACAACAAGGAGAAAAT
CAAAACTAAAAAAAATAATTATCCCCAAAATTGATAAAAAAGAACTCTGAAAGGCATAAT
ATTGTTGTACCAATAGCTTCTCCATCCTTAGAAAGCAAAAAGACTCCTTTCTTTTCAGCT
CAGTGCACTCCTATAAAAGGATTAAATGATAATGACTCTGACTCATTATCTAATAGCTCT
CACTCTTCATTTAAACTTGAGCCTTCGTTTTTCATATTCTTCATGAAAAAATATGGAAAA
TACTTTTTAGATTCTTAACAATAATCTCCAAAATTATCTGATCTAGTAAATATGAACACT
TAATAATATGAGCAAGACTGTATCATAGAAGACTAAAGTGTAGAAAGAGAATCTTCAAAA
TCAATTTCACAATCATCTGTAACCAGTAGTCCTATTATAAAAAGACGCTAAGCAACTGAA
AGAGCTCAAAATTTTATGGATTTAGAAGAAGACTATGGTTCTTCAGAAATGCCCATTCTC
AGGAAAAAACAAAGTTCTTTTTCTGCTTACTCCAACTAAAATAAAGGTTTATTGTCTTTA
TACACAAATACTGACTTTAATACTAATATGATATCAAATGAACAAGCCGTTTCATCTCCT
CCTATTAACAAGTATTAATGTGATTTAGAAACAACAGACGACTAAAAGTAATTGAAAATA
GTAAATTTCAGAAAAAAACTTAAAACTGCTGATTTTACTAACAATGCCAATTTCTCACTT
TCTTTAACCTAATAATAGTAACACTAATGA


>TTHERM_00721600(protein)
MLPQNNQIDIAQILKDFYIPENSLATNRIHTNNLFQTGLTQQQQQIISLLNCQQQSQQLQ
SPQSQELQERLNLYLHQQQLQIQQQQIQLSDLVALSAQLSAGNPALFNNALTQQSTPNQM
NIEITQQPQGINHLNKQINLLTESNPISNAFNNTAQANTMSKTAQPSFNYSSSAQNMIFQ
NLQNQLTTPSSRSIIESFSEQNSQSNISIQKSNFSQNPNSNVSANNSDNAANSTINKSPS
ATQNSVNQPVKSINYNNTIQNPNGSNTGRWTREEHLRFVKGLGMYGKNWKKVEEYVGTRS
GAQIRSHAQKFFNKIQRENAKSNSKSGNNGKNGNLQSEDSFPQMRKRQQSTQSNYSCDFA
SDDGEGENDLQNQNQLEEIVPQQSKQKDAKEWLHYYKLLQQTCQQNLEAQKQNKNLSEEQ
IQQQEEQLKKIQIFIQLLSACDNINQHIDCASPMSQGSPMASLLPFSFDNLNINSPLMNA
SPGQQQNLKPQDPHQIADINSFSLDSNQGDHTKFGQNLSKQSNFGLNSKQMHFGSLFKKY
HEANSDFNDQQSNTSQNSVESKIEGKNESFSNNPCGIIQSKLKIDNQTKTQRESETQISN
RQLSKSTDIQTNSRVSKISSNSVEESNLQDGEDEEEISEQATNRPNNLSNSAISSNNDQN
STFSTPENQKLANQGNGNQNNSNNSQNNYFNNFQFVGENIDIESDFSKIKNLSNQQQGEN
QNQKKQLSPKLIKKNSERHNIVVPIASPSLESKKTPFFSAQCTPIKGLNDNDSDSLSNSS
HSSFKLEPSFFIFFMKKYGKYFLDSQQQSPKLSDLVNMNTQQYEQDCIIEDQSVERESSK
SISQSSVTSSPIIKRRQATERAQNFMDLEEDYGSSEMPILRKKQSSFSAYSNQNKGLLSL
YTNTDFNTNMISNEQAVSSPPINKYQCDLETTDDQKQLKIVNFRKKLKTADFTNNANFSL
SLTQQQQHQ


>TTHERM_00721600(gene)
ATGCTCCCCTAAAATAACCAAATTGATATCGCTTAGATATTAAAAGATTTTTATATTCCT
GAAAACTCTCTCGCTACTAATCGGATACACACAAACAATCTATTTCAAACTGGATTGACT
CAGTAATAGCAGTAAATTATATCATTGCTTAACTGCTAGCAGTAATCATAGTAGTTATAG
AGTCCTTAATCTTAAGAGCTACAAGAAAGACTTAATCTCTACCTTCATTAGTAATAATTG
CAAATCTAACAATAATAAATCTAACTTTCTGATTTAGTAGCTCTCAGTGCTCAATTATCA
GCTGGTAACCCTGCTCTATTTAACAATGCCTTAACTTAATAGAGTACTCCTAATTAAATG
AATATTGAAATCACTTAATAGCCTTAAGGCATCAATCATTTAAATAAGTAAATAAACTTA
CTTACTGAATCTAATCCTATATCAAATGCCTTCAATAATACTGCACAAGCAAACACAATG
AGCAAAACAGCCCAACCATCCTTTAATTACTCTTCTTCTGCTCAAAATATGATCTTTTAA
AATTTATAAAATCAATTAACCACACCAAGCAGTAGAAGTATCATCGAGTCTTTCTCTGAG
CAGAATTCTTAATCTAATATCTCTATTTAAAAATCTAATTTTTCTTAAAACCCTAATAGC
AATGTTAGTGCAAATAATAGCGATAATGCAGCAAATAGCACTATTAATAAAAGTCCTTCA
GCCACTTAAAACTCAGTCAATTAACCAGTAAAATCAATCAATTACAACAATACAATCTAA
AATCCTAATGGATCTAACACAGGGCGTTGGACTAGAGAAGAGCACCTACGCTTTGTAAAG
GGTTTGGGAATGTATGGAAAAAATTGGAAAAAGGTTGAAGAATATGTAGGAACACGTTCA
GGAGCTTAAATTCGTTCTCATGCTTAAAAGTTCTTCAACAAAATCTAAAGAGAAAATGCA
AAAAGTAACTCAAAATCTGGAAATAATGGCAAAAATGGAAATCTACAATCAGAGGATTCC
TTCCCATAAATGAGAAAGAGACAACAAAGCACGCAAAGCAACTATAGCTGTGGTAAAAAA
TAAATTTTCATTTTAAATTGATAAAAAAAATACAAAAATTTAAAAAAAAACAAATTAGCA
TGAATGAAAGCAAATTTTTTGTTTTTTTTTCCTCTTTTTTTTACTCTCTCCCTTTCAGCT
TAATTTAATTGATTAGAATTGTGGATTTATTAAATAGAATTTTTAATTAATAAAAAATTT
AACTCTTAACGCAGCTAGTATAATCCTTGAATTAAAATTATAAATCACCCAAAAGCTAGA
TTTTCTTTAGATAAATAACATATTAATTATCTATCATAAACACAATTTATTTAGCATATA
AAATAATAAATTTTAAAGATTATTAATTTATCAATTTTATATAAGATTTTGCCTCAGATG
ACGGAGAAGGTGAAAATGATTTACAAAATTAAAATTAATTGGAAGAAATTGTCCCTCAAT
AAAGTAAATAAAAAGGTAAAATATTTTTTTGTTTATCATTTTGGGTATTGAATTTCTCAT
TTAAAAAATAGATGCAAAAGAGTGGCTCCATTACTATAAACTATTATAACAGACTTGTCA
GTAAAACTTAGAAGCCTAAAGTAAATAATGAATTATTTTAATTAAAAATATTGTTTTACT
TAAATATTTTTTTATTAAAAGAGCAAAATAAAAACCTATCAGAGGAGCAAATACAGCAAT
AGGAAGAACAACTTAAAAAAATATAAATATTTATCTAACTTCTATCTGCTTGCGATAACA
TCAACTAACATATCGATTGCGCTAGTCCAATGTCATAGGGATCTCCAATGGCTTCACTCT
TACCTTTCTCTTTTGATAATCTCAACATAAATAGCCCTCTTATGAATGCTTCTCCTGGCT
AATAATAAAATTTAAAGCCTTAAGATCCTCATCAAATAGCAGATATTAATAGCTTTTCTC
TTGATTCAAACTAAGGAGACCATACAAAATTTGGTTAGAATCTATCAAAATAAAGCAATT
TTGGCCTAAATTCAAAGCAAATGCATTTCGGTTCTTTGTTTAAGAAGTACCATGAAGCTA
ATTCTGATTTTAATGACTAGCAAAGTAATACAAGCTAGAATTCAGTAGAGAGTAAAATTG
AGGGAAAAAATGAAAGCTTTTCCAATAATCCTTGTGGAATTATTTAATCTAAGCTAAAAA
TTGATAATCAAACAAAAACTCAAAGAGAAAGTGAAACTTAGATAAGCAATCGATAATTAT
CAAAATCCACTGATATTCAGACTAATAGTAGAGTATCAAAGATATCATCTAATAGTGTTG
AAGAAAGCAATTTATAAGACGGTGAAGATGAAGAAGAAATTTCAGAATAAGCAACAAACA
GGCCAAATAATTTATCAAATTCCGCAATAAGTAGCAATAATGATCAAAATTCCACCTTTT
CTACACCTGAAAATTAAAAGCTTGCAAATTAAGGAAATGGAAACCAAAACAACTCAAATA
ATTCATAAAATAATTATTTTAATAATTTTTAGTTTGTTGGAGAAAATATTGATATAGAGT
CAGACTTTTCTAAAATAAAAAATCTATCAAATTAACAACAAGGAGAAAATCAAAACTAAA
AAAAATAATTATCCCCAAAATTGATAAAAAAGAACTCTGAAAGGCATAATATTGTTGTAC
CAATAGCTTCTCCATCCTTAGAAAGCAAAAAGACTCCTTTCTTTTCAGCTCAGTGCACTC
CTATAAAAGGATTAAATGATAATGACTCTGACTCATTATCTAATAGCTCTCACTCTTCAT
TTAAACTTGAGCCTTCGTTTTTCATATTCTTCATGTAATAAAAAATTATTTATACATTTT
TATAACTAGTATTAATCTTTCTTAATATAAAATAGGAAAAAATATGGAAAATACTTTTTA
GATTCTTAACAATAATCTCCAAAATTATCTGATCTAGTAAATATGAACACTTAATAATAT
GAGCAAGACTGTATCATAGAAGACTAAAGTGTAGAAAGAGAATCTTCAAAATCAATTTCA
CAATCATCTGTAACCAGTAGTCCTATTATAAAAAGACGCTAAGCAACTGAAAGAGCTCAA
AATTTTATGGATTTAGAAGAAGACTATGGTTCTTCAGAAATGCCCATTCTCAGGAAAAAA
CAAAGTTCTTTTTCTGCTTACTCCAACTAAAATAAAGGTTTATTGTCTTTATACACAAAT
ACTGACTTTAATACTAATATGATATCAAATGAACAAGCCGTTTCATCTCCTCCTATTAAC
AAGTATTAATGTGATTTAGAAACAACAGACGACTAAAAGTAATTGAAAATAGTAAATTTC
AGAAAAAAACTTAAAACTGCTGATTTTACTAACAATGCCAATTTCTCACTTTCTTTAACC
TAATAATAGTAACACTAATGA