Identifiers and Description

Gene Model Identifier

TTHERM_00716260

Standard Name

None

Aliases

PreTt19098 | 113.m00137 | 3673.m00061

Description

small GTP-binding domain protein; small GTP-binding protein domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00350 ) Dynamin family
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00716260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16898.19.997093137033517e-262small GTP-binding protein doma
in-containing protein (463 aa)
OxytrichaContig19698.0.g501.0000521619018958e-7750S ribosome-binding GTPase
DictyBaseDDB_G02886099.000751454575209e-33eral1 on chromosome: 5 positio
n 1740020 to 1741216
Stentor CoeruleusSteCoe_367801.2995814250075031e-24
WormBaseWBGene000084560.000000000000008002679274403579Uncharacterized GTP-binding pr
otein E02H1.2 status:Partial
ly_confirmed UniProt:Q09523
protein_id:CAA87384.1
SGDYMR023C0.0004000184047659232MSS1 Mitochondrial protein, fo
rms a heterodimer complex with
Mto1p that performs the 5-car
boxymethylaminomethyl modifica
tion of the wobble uridine bas
e in mitochondrial tRNAs; simi
lar to human GTPBP3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00716260(coding)
ATGTTAAGCAATATTATAAGATTTAGATTTTCAATAAATGATAGATTAAAAAGATTTAAG
CCTCCTACCAAAATAGAAAAGCAAGTGCCTAAATATTATCCAATATAACATCCTAGAAAG
ATAGATTCTCATGATTCAAGCATAATTACTCATGATAAGCCAATTCATTATGTCACACCT
AGATTTGAGGTTCCGATTGAAGTTTATCGTGATCCTAATACAGAATTAGCAGAATTTGAG
TAACCCCTCAACCCTAAATCCTTAGATGTTGCACTTTTAGGTCCTCCTAATGCGGGAAAA
TCTAGCTTAATGAATTATATAGTAAAATCTTAAATTAGTGCAGTTTCAAATAAGGCAAAT
ACAACATACGAAAGCATATTAGGTGTACATACTAATCTGGAAAAGCAAACTCAAATTTTA
TTCTATGATACTCCTGGTATCACTAAATAATATAAATACTCAAAAGCATATGTTACTAGA
GCTTGGGATATTTTAAATGATGTAAACAAAGCTATTTTTATGATAGACGGAGTCAAAACC
TTGGATGATAAGATAAGAGAGGCTCTTAAAAGATTAAACAGTTTGAAATATAATGAAAAA
GCTAATAAAAAAATAGATTAAATTACATAATTAAATTAAGATGATCCTGTTTATAAGGAA
AAGCTGAAACACATATTAAGTACTGATCATAATAAAGCAGATATCACTGATGAGTCATAT
GGTTCTTCTTCTTTTCCTAAAGTTTTAGTTGTCAATAAAATGGATTTATGTACAAATAAA
AAAAAGTTAAATTGGATAGTTTCAGAAATTGAGGATCTTTCTAAGTTTGACCATAAATTT
TTTATTTCATGCGAAACTGGATATGGAATCCCATAATTATTAGAATATTTAGAATCAGAA
GCTATTCCTTCATAATGGAAAAGACATCCTAAAATAAAAACAGATCTTTCAAAAGTAGAT
ATTATAGAGTAGATTGTAAAATCTGCTATTTTTAGTAGATATTTCGAAGAAGTACCTTAT
CAAACAGGTATATCTCTAAAAGAATTCAGTTAGAGAAATGATGGACTAATTAAATTACAT
TTTGAGTTAGACGTTTAAACTGAGCATTAAAAAAAAATATTAACAGGTTATAAAGGAAGA
AATGTTTTAGAGTTGATAAGTTAAACAAAAATTGAATTGATAAAACTTTTTTAAAGGGAT
TTTGACATTACTATCAAAATCAAAGTAAGAAAAAGTAGTTTGGAGGAAGAGAACTTCAAA
GTAGAAGAAATTACATCTGATAATTATGGAGAACGAGTAACAGAAAAATTACTGCTACAG
CATAAAGAAGGAAGAAAATAAATAATTGAATAATTAGAACATTTTCTAACTTACCCTCTT
TTAAAATGA


>TTHERM_00716260(protein)
MLSNIIRFRFSINDRLKRFKPPTKIEKQVPKYYPIQHPRKIDSHDSSIITHDKPIHYVTP
RFEVPIEVYRDPNTELAEFEQPLNPKSLDVALLGPPNAGKSSLMNYIVKSQISAVSNKAN
TTYESILGVHTNLEKQTQILFYDTPGITKQYKYSKAYVTRAWDILNDVNKAIFMIDGVKT
LDDKIREALKRLNSLKYNEKANKKIDQITQLNQDDPVYKEKLKHILSTDHNKADITDESY
GSSSFPKVLVVNKMDLCTNKKKLNWIVSEIEDLSKFDHKFFISCETGYGIPQLLEYLESE
AIPSQWKRHPKIKTDLSKVDIIEQIVKSAIFSRYFEEVPYQTGISLKEFSQRNDGLIKLH
FELDVQTEHQKKILTGYKGRNVLELISQTKIELIKLFQRDFDITIKIKVRKSSLEEENFK
VEEITSDNYGERVTEKLLLQHKEGRKQIIEQLEHFLTYPLLK


>TTHERM_00716260(gene)
ATGTTAAGCAATATTATAAGATTTAGATTTTCAATAAATGATAGATTAAAAAGATTTAAG
CCTCCTACCAAAATAGAAAAGCAAGTGCCTAAATATTATCCAATATAACATCCTAGAAAG
ATAGATTCTCATGATTCAAGCATAATTACTCATGATAAGCCAATTCATTATGTCACACCT
AGATTTGAGGTTCCGATTGAAGTTTATCGTGATCCTAATACAGAATTAGCAGAATTTGAG
TAACCCCTCAACCCTAAATCCTTAGATGTTGCACTTTTAGGTCCTCCTAATGCGGGAAAA
TCTAGCTTAATGAATTATATAGTAAAATCTTAAATTAGTGCAGTTTCAAATAAGGCAAAT
ACAACATACGAAAGCATATTAGGTGTACATACTAATCTGGAAAAGCAAACTCAAATTTTA
TTCTATGATACTCCTGGTATCACTAAATAATATAAATACTCAAAAGCATATGTTACTAGA
GCTTGGGATATTTTAAATGATGTAAACAAAGCTATTTTTATGATAGACGGAGTCAAAACC
TTGGATGATAAGATAAGAGAGGCTCTTAAAAGATTAAACAGTTTGAAATATAATGAAAAA
GCTAATAAAAAAATAGATTAAATTACATAATTAAATTAAGATGATCCTGTTTATAAGGAA
AAGCTGAAACACATATTAAGTACTGATCATAATAAAGCAGATATCACTGATGAGTCATAT
GGTTCTTCTTCTTTTCCTAAAGTTTTAGTTGTCAATAAAATGGATTTATGTACAAATAAA
AAAAAGTTAAATTGGATAGTTTCAGAAATTGAGGATCTTTCTAAGTTTGACCATAAATTT
TTTATTTCATGCGAAACTGGATATGGAATCCCATAATTATTAGAATATTTAGAATCAGAA
GCTATTCCTTCATAATGGAAAAGACATCCTAAAATAAAAACAGATCTTTCAAAAGTAGAT
ATTATAGAGTAGATTGTAAAATCTGCTATTTTTAGTAGATATTTCGAAGAAGTACCTTAT
CAAACAGGTATATCTCTAAAAGGTAAACAATAAATTATAAATATTTTAAATTAGAAAGGT
TTCCTTTAACTTCAAATAAGGATTTACTTAATTTTTTCATAAAATATTAATTATCATTTT
ATATGCAAAAGCATAAAATAAATAAAATTTTCTAGAATTTAAAAACATTAACTTAATTTA
ATAAAATAGAATTCAGTTAGAGAAATGATGGACTAATTAAATTACATTTTGAGTTAGACG
TTTAAACTGAGCATTAAAAAAAAATATTAACAGGTAAATAAATATTTGTAACTTTATATA
TTATTAGATATTAAGAATTTCAAATATATAAAATCAAGGTTATAAAGGAAGAAATGTTTT
AGAGTTGATAAGTTAAACAAAAATTGAATTGATAAAACTTTTTTAAAGGGATTTTGACAT
TACTATCAAAATCAAAGTAAGAAAAAGTAGTTTGGAGGAAGAGAACTTCAAAGTAGAAGA
AATTACATCTGATAATTATGGAGAACGAGTAACAGAAAAATTACTGCTACAGCATAAAGA
AGGAAGAAAATAAATAATTGAATAATTAGAACATTTTCTAACTTACCCTCTTTTAAAATG
A