Identifiers and Description

Gene Model Identifier

TTHERM_00703530

Standard Name

None

Aliases

PreTt20129 | 110.m00102

Description

Chlamydial polymorphic outer membrane protein repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01257 ) rim ABC transporter
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF02415 ) Chlamydia protein of unknown function
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF03748 ) flagellar basal body-associated protein FliL
  • ( TIGR01376 ) Chlamydial polymorphic outer membrane protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 49.9%

TetraMine Data

TTHERM_00703530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15301.19.997093137033517e-262hypothetical protein (2159 aa)
OxytrichaContig16309.0.g144.0000945465895345e-86hypothetical protein
Stentor CoeruleusSteCoe_92731.2160992992528256e-37
DictyBaseDDB_G02849135.000468829272308e-18DDB_G0284913 on chromosome: 4
position 2638616 to 2643148

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00703530(coding)
ATGAATTTTCATTCTTATTTGTCACTCAAACCTATAATAATTCTTATAATTGTACATTAA
ATGCTCAGTTTTTTTAGAATTGTTTTGGCTGATGGGACTTGCTCTTAAACAGGTTGCATT
TCATGTCCTCATGGATAAGAAGCTTGTTATTAGTGTACTACGAGTTTTGTATTAATAAAC
TATAATTGCTTACCTATCGCAGCTTAATCTGTAATCTCCTACTTTGCAGTCCAAGATGGA
AAAGGATAGCTGGTTTAGTACTCTGAAATTTGCCCCGAAGAAACAAGTTACATCGATGAC
TCAGTAACTCCATCTCTTTGCATTCCATGTCCTAGTTAATGTGATGGTTGCTTTCTACAT
GGATCCAGAAAAGTGTAATGCTGGGACTGTGCTTAGGGATATTATATGTAAAATTCATTA
AATTATTAAGAAGCAGACAGATATAGTTCTTCATGGAATCCAACTTGTGTTCAAATAAAT
TAAGCACAAACGTTAAATTTAGTAATCACAATCACTACTACAGTTTAAAACGCTGAGCTT
TAATCAATTCCTAATTACAATTGTGCTAGTCAATCTTTAACTTTTGGCAGTTTCTTCACT
GCACTATTATTTGTTGAAAATGTGTGCTCTCAAAAGTATAGCTAAGGACAACTTACATTT
ACCTTTTAGAACGGTAATCATTTTATTATGATAGATAATGTTGCCTACTCTGGTAAAGAA
ACTGATCCTGACTTTGTTTTCGAATTTTTCAGAAATTCTAATTATGATATAACTATCAAT
TCTGCTTCAAGTAAAAACTAGGTGATTCTATACTGGAGAACTGAAAAAATTAGATTTTAT
ATCTTTGGTACTTTGAATTTATCAGGAGTTACAATTGATGGAAGTGAAAACAAACTTTAT
TCTAATTTGAGTGATCCATCTAAATGCTTCACATAAAGAAACTTATGCTGCAATGGAGCT
ACACCTCAAAATTATGTATGTAATAATGGTCCAAAAAGATAATATAGAGCGACTGGAAAA
ACTTATCAGCCTGATGCTGTTGGTATGGGTTTATTTAATTTTATGTCTTCTAAAAGATAC
ACAGATACTGTCATACCTTCTATAACAATTAATGCTGTTGATGTACGCAATATGATGATG
TTTTATCCAGACGGTATAAGATATTTCATAAAAATCCATTCTAACTATGGTTTTATCAGC
TTAAGTAATGTTAATGTAGATAAATATTATTTCACTGGAGGTTTAATCTCTAATTATAGA
TATGTATAACCTAAAAGAGAATCTTATAGTTATATCGATTAAGACATTGGATTATAAAGG
AGAACTGATTGTAGGATGCAAGTTGCAAATTTAAAATAGGGGACTTTTTGTCTTCTCATA
TATTTAACATCTTCAACTTTTCAAAACTATAACTATGAAAAATATACACGTTTATTTTTA
GATTATACTGATAATCCAAAATTTATAGAGAGTTATACCCTACATCTGTTTTCCACTTTA
GCTTCAGTTAATATCTCGTAAAGTAAATTCCTTAATGCAATGGTATCTTCAACTATGGTT
GATGCTGACAAAGAATTTTTTATAAGTTCTTAGGTTATGTAGTGCAAAAATAGTTATGAT
TAAAGCTCAGAAAGTGACTTATTAAAGTCATCTTATCTTAAAACAAATCCCAATCAGCAC
TTTGATTAGGATAAAATCTCTTAACACACTTAAATGCTTGGTTCGCACATCGTTTGGTAA
TACATTAAAGGAAAATTATTAATGGATACTAATACATTCGATTCGAATATAGGCTACTAA
AATCCTGCTATTTCAATGATGGGTTATTCCTAATATATGGGAGCAAGTTTATAAACCTCA
TATATAATACTTGATTCAAATGGTAACTTTGCTTATGTAGCAAATGCTGTTATATTTATA
CAAAATAGTATATTTACCAATAATTTTGCGTTTGTTGCAAACAGCGTAATGTCTTTTTAC
TAAAATTAAAATTCTAAGCCTTTTAATACTGGCTATATGAGTTGTATGGGAATGAAGTTT
CTATCTAATACATTTTAGAATAATTTAGGGTGTCCTACAAGCTATTTTGTTGTTAGTATA
AATTGCAGATTCTAAACTTTAACTTCATCATTTGCTAATAATTGGTACTAAGAACTTAAT
CCAACAAATACTTAGTAAGAAAATAATGATCTTCTCACATAAGTTGTATTTAGGTCTAAT
AAATTCATACAAAATTATGCAATTATATCAAATAGTCTTTTTATAACTGGTGCTAGAGAT
ATTAACATTGACTAAAATACTTTTGATAGTAATGGAGTATTGATAGATTAAACCAAAGGC
TAGATTAACACTAATAACAACCCTTACATTAATATAGTAAATTACAATAAGGCTACTTAT
CCATACTTTAATACTAATTGGATGACTGAATCATCAGCTTTATTCTTGCAATATCCTGTT
TCAACTTTTATAACAAACAACATATTCACTCAGAATTGGGCCTTATCTAGTGGTGATAGT
TATATTGGTTAATCAGTTATGCTTCATAAAATAGTTTCTGTTACTGATGTTAAAATTTAC
AATAATTAATTTTTAAACCACAACGGACTACCTTCAAGTTTTATTACTCAAGGCTCTTAA
ATAGGATAAGCTTACTCAACTCTGCCAATAATTTCAGTGAATTTGTATACAAATTACCAT
CTTGCTAAATCAATTAGTGTTGCTATACAAATTGATTTCTATTAGAATACTTTTGCAAAC
AACTAATACAAAATTAATACTAATAATGTAGATACACAAAATATAAAATATAAAACCTAC
ACTCTATATTCGTTAGGAGGTTTTGTTCAGCTCATAAAACTATTTACTGATAATGAGGTT
CTAGGTTCACAACCTGTTTCAAATGATTATTTATATATGATGTATAGTCAAGTCAATTTC
TTAATCAGAAACTCAAATTTCACTCAAAATACACATTATAATGGCGGTTGCCTAATTGAA
GTTTCAGGACTAAATTAACTATAAGGGTACGGCAATACATTTTCAAGTAATAACAATGAC
TTCTAATCAGCGATAAATAATTAAATTGGAGGAATGATTTGCATGCTTCAAAGTAGCCCT
GTAACTCTAGCTAACACTACAAATAATGAACCTATTCTTAATCTTATGCAATCAACAGTT
ACAGGTGACAAAGGAATTCATGTTTAAAACTAGCTAGTCGGTTCTTACATTGAAATAGGA
GACATGAATTTTATTGGGTTCTAATCATCGAATTCAATTTTAATTTCATCAGATTCAGGC
TAGGTAAATATGGAAGGTAACTTATTTAACAGTTCAGTAGCAATAAATGGATTGATGAGC
TTTAAAAGAGTAGGAAAACTTATTCTTCAAGATTTACAAGTTTTATAATCGTTCCCTTAC
ACAATATATCTTGAGAGCGCATACAATTATTAGCTGAATGGATTAACAATTTAAAATAAT
AATTTGAATTTATTCTCTAGTTACATCTTATCTAAAATGAACTAATAGGATTATACAAAT
TTGATAAACAGTGGAGTACAGGTTTTGTATTTATACAGATCAAGAGGTATAATGCTCAAC
AGTAATTTTAATAATAATTTAGTTTCAAGTGCTTCTGTAGCCTTATTAAGAGATAACAGT
TTACTCACAGCTACAAATCTAAATGTTACAAATAACCTTGCTTAAAATATTGGAAGTAAT
TTTTATGTCACAGATACTTCAGTTCTCAATTTAGTTCTCTCCAATTTCTAGAATAACACT
TCTTTGCTAAACGGAGGATGTTTCTTTATATAAAACTCTTATTTTAGCATTAGTTAAACA
AATGTTTCATTTTGTTAATCAAAATAAAATGCTGGAGTTGGAAGAATAGAGCAGTCTATT
GTAGATATTAGCAACTCAACATTTTAAAATAACACTGCTCTTCAAGAAGCAAGTTTGTTA
TATTCAATTAGTTCAGACATAAATATCAAGTTTTCAAAATTTTTCAATAACTCAGCTAAT
TCGTGTGGTATTATAGCAAGTACTGTAAATCTTTTCATCCTTGGTTCCAATTTTACTGGG
AATAGTGCAAATATAAAAACAAAGAATATATATGCCACATAATCAACTCTTTAACTATAA
GACTCTTTTTTCAATGATACTCAGCCAATCAATCAGGTTTCAGGGGCATTCATTTAGTTA
TTTAAAAGTACAGGCTAAATATCTTCATCTCAATTCTATAATGGTTAATCAAACTATGGT
GGAGCAATTATGGTTGAGGCTTTTTCTGATGTTCAAGTAGATTCTTGCTTATTTAATAAT
AATTATGCTGTCTAGTCTGGTGGAGCTATAGCAAGCTCTAGTTATTTATCAGTATCTAAT
AGTAACTTTACTTTAAATTAAGCCTCTCTTAATGGAAATGATGTATTCATAAAATGCTAA
GATGATTTTCTAGTCACAAATGTAAGAGTCAACGCTTCATTGGGTATCAGCTTGTATGTT
TGGGCTAGATCATTTTAAGCTTACTAGCTTAACATAACTGGTAACTCTTCCCTAATTTAA
TAAAATTAACTAAACTAAATGAAAGGTGTGTACTTATTTTAAACTCCATCATCTATAGTA
TAAGATAGTTATTTCTCTAATCTATTCTCGATAAAAGGGTCTGCACTCAATATAGTAAAC
TTGCTAAACTAACAAGTAATGAAGACACAAATAATCAATACTGTTTTTACAACAAACTAA
GCACAATAAGGAGGAGCTCTTAAAATAGATGGGTTGACAAATACTTATATCATAGATACT
AATTTCTACAACAATATAGCCTATTATTTTAATGACACTATAGGAACTGGTAATGGAGGA
GGCATACATTATTCATGTCCTCTTACCTTCAGTTACTGCTCCTTGTAAATTGTTAGATGT
AGTTTTATCGATAATTAAGCTGAAATGGATGGAGGTGCTATCAAATTTGATTAATCAGAG
GTCTCAATTGATTTTTAAACATAATTTGCTAATAACTACGCCATATATGGACCTGACAAA
GCATCTTATCCTATACATCTCTATAAAACTAACAGTACCAACTAATCAGCAATTTCTGAT
TTTTAGAATCCAAATGCTTTTTCTTCTGGATTTCAAAAATTAGTAGAAGATTCTTATAAC
TTTGAAGCAGAAGTATCTGGCTAGAAATTCGAAATATATTATGCTCTTGTTGATCATTAT
GGAAACATTGTCCTAACTGCTAATTCATCTTACGCCAGATTTTCTACATTCTCATCGGGA
GTATATTTGGAGAGTGGAAATCAAGTTTCTAAAAATGGTTATTTTAACTTTACAGACTTT
GTCGTTACAATAAATCCAGGAGATACTTTACAGATGATGATAGAAACGGATTCTATTCCA
GATGAATGGTTAGAAAAAGCTCGTAATTTACAGCTTAAGTCTTAGCGTCTGCGCTAATTA
TAGTAAGGATAGTCTTTAGATTTATTAAACTTAAATAACTCAAAAGGAACAGTCCCAGTA
TATGCTTAATTCCGTAAATGTAAAATTGGAGAGATTTAAGATTCTAATAAATGTGTACCT
TGTAGTTATAACAAATACTCCAATGTTGCTAATATTACTGAAGGTTCAGTCTAATGCAAA
GAATGTTTATAGAATTCATTTTGTGAAGGACTCAATAATGTAGCTCCTCTTTCAGGGTTT
TGGAGATTGACAGATATAAGCGAAAATTTTATGTAATGCCCTAATGCATAAGCCTGCTTA
GGTGGAGTAGTTGATGGAGAAATAAATTCAAATACTGGTTCTTGTGAAGTTGGTTATGAA
GGAAATCTTTGTTTAGCATGCTCTGATGGTTATGCTAGATATGGATAATCTGAATGTGTA
ATTTGTTAAAATAATATTCTGTACAACGTTAGAGCCATCGTGACAATAATAATTACTTTA
GGAATGATTTCTCTTGGTATTAAAAACTAATTGGATAATTAAGGTTCATAAAAAGATTAC
TCAATTTGTTTGATTAAAATATTTGGAAACTTCACTTAAACTATTAGTATTATTTCTCTA
TTTTAGTTGTAATGGCCTTCTTCTGTTGGTTCTGTGGCTAGTATCAACAATTAATACCTT
GCAGCACCATTACAAGTTTTCTCTATGGATTGCTATTTCAGAGGATTTGGAGTTAGTACT
TCTTTGGTAAGAGTATTTATTACTATTGTTACTCCTTTGGTTGTTATGCTTTCATCAATC
GTTTTCTTCTGCATTTATTATTCGATAAAAGTAGGAATAAAGCTCTATACAGATAAAGAT
TATCAAAAAAAACTTAAAAATGCAATCATCATCACCCAGCTAGTCATTATTTTTGTATTT
CATCCTCAAATTGTCACAGCTTCGTTTTCTCTATTCTAATGCTAATAATTAGGAGATAAT
GCAAATCCTTAAAAGTTTTCACAAATAGAGCCTCAGCTTAAGTGTTTTGAAGGCGAGCAC
TTAAATTGGGTTAAATATCTTGGTATACCTTCTCTAGTACTATGGGTTTTTATTATTCCC
TTAATCATGGCTTTAGCATTGTGGAAGTATAAAGATATAATAGATAGACCTGATATTGTT
GCCACTTATGGATTTATTACAAAAGGTTACAGAGCAGAGTTTTTCTTTTGGGAAATTGTT
ATTATGTATAGAAAATCTATACTAGTCATTGGAAGCATATTTTGGAAGTTAGATCCTTTC
CTAACAGGTCTAAATATATTACTCTATCTTTTCTTTTGGCTAATAATTTAATAAAAATTC
TAACCTTTCTTAACTGGCTAACTAAATAAAGTGGAAGAATACTCTTTACTCACATCTGTA
TTCTTCATCTACTTTTCTCTTTACTTTATTGTTGACCAACATGGATCAGTGATTAGTATT
TTGATGATAATTTTGCTTATGGTTACTTATATTGGATATTATGCATATTTTGGCTTGGTT
TATTCTAAATAAAAGATAATTGAAGTCACAGAAACTATTACAAACCTTTCTTAAGAAGTC
AAACATCCATTTTTAGTAGTTGTATTTGGCAGATTAGCAGAGATAAAAATTTTATCATGT
GCTAAAAATTGGTTTTTAGAGCAAAAAGAACTTGTTCAAGCTGCTATTTTAAGATAAAAA
GTCCAGCAAGATGAAAAACTAAACAAAGAAATCTAAAATTGCAGTAATTAGCATGTAGTT
AAGGATTAAATAAAGGAAGTAGTTTAATAGTAGTCAATAAGTTAAATTAGCCAATAAGAT
GTCTTTTTGTAAATAAAAAAGAAAAATAAGGAGCTATTTTAAGCAGCTTAAAAATTCACT
GATATCCTATTAAAAAAGAATGAAAAAATATAAATTAATGATAAGTTAAAAAATTTGGCA
AAGAAGGTAAGGCAAAAAAAAGAAGATCATGATGACATGATACCTCTTAATTAAGACTTT
TAAAATGCAAAAGAAATTACAATATAAGAGGAATAAAATTCTTTTGAAGATGAAGGAAAT
ATAAATATTTGA


>TTHERM_00703530(protein)
MNFHSYLSLKPIIILIIVHQMLSFFRIVLADGTCSQTGCISCPHGQEACYQCTTSFVLIN
YNCLPIAAQSVISYFAVQDGKGQLVQYSEICPEETSYIDDSVTPSLCIPCPSQCDGCFLH
GSRKVQCWDCAQGYYMQNSLNYQEADRYSSSWNPTCVQINQAQTLNLVITITTTVQNAEL
QSIPNYNCASQSLTFGSFFTALLFVENVCSQKYSQGQLTFTFQNGNHFIMIDNVAYSGKE
TDPDFVFEFFRNSNYDITINSASSKNQVILYWRTEKIRFYIFGTLNLSGVTIDGSENKLY
SNLSDPSKCFTQRNLCCNGATPQNYVCNNGPKRQYRATGKTYQPDAVGMGLFNFMSSKRY
TDTVIPSITINAVDVRNMMMFYPDGIRYFIKIHSNYGFISLSNVNVDKYYFTGGLISNYR
YVQPKRESYSYIDQDIGLQRRTDCRMQVANLKQGTFCLLIYLTSSTFQNYNYEKYTRLFL
DYTDNPKFIESYTLHLFSTLASVNISQSKFLNAMVSSTMVDADKEFFISSQVMQCKNSYD
QSSESDLLKSSYLKTNPNQHFDQDKISQHTQMLGSHIVWQYIKGKLLMDTNTFDSNIGYQ
NPAISMMGYSQYMGASLQTSYIILDSNGNFAYVANAVIFIQNSIFTNNFAFVANSVMSFY
QNQNSKPFNTGYMSCMGMKFLSNTFQNNLGCPTSYFVVSINCRFQTLTSSFANNWYQELN
PTNTQQENNDLLTQVVFRSNKFIQNYAIISNSLFITGARDINIDQNTFDSNGVLIDQTKG
QINTNNNPYINIVNYNKATYPYFNTNWMTESSALFLQYPVSTFITNNIFTQNWALSSGDS
YIGQSVMLHKIVSVTDVKIYNNQFLNHNGLPSSFITQGSQIGQAYSTLPIISVNLYTNYH
LAKSISVAIQIDFYQNTFANNQYKINTNNVDTQNIKYKTYTLYSLGGFVQLIKLFTDNEV
LGSQPVSNDYLYMMYSQVNFLIRNSNFTQNTHYNGGCLIEVSGLNQLQGYGNTFSSNNND
FQSAINNQIGGMICMLQSSPVTLANTTNNEPILNLMQSTVTGDKGIHVQNQLVGSYIEIG
DMNFIGFQSSNSILISSDSGQVNMEGNLFNSSVAINGLMSFKRVGKLILQDLQVLQSFPY
TIYLESAYNYQLNGLTIQNNNLNLFSSYILSKMNQQDYTNLINSGVQVLYLYRSRGIMLN
SNFNNNLVSSASVALLRDNSLLTATNLNVTNNLAQNIGSNFYVTDTSVLNLVLSNFQNNT
SLLNGGCFFIQNSYFSISQTNVSFCQSKQNAGVGRIEQSIVDISNSTFQNNTALQEASLL
YSISSDINIKFSKFFNNSANSCGIIASTVNLFILGSNFTGNSANIKTKNIYATQSTLQLQ
DSFFNDTQPINQVSGAFIQLFKSTGQISSSQFYNGQSNYGGAIMVEAFSDVQVDSCLFNN
NYAVQSGGAIASSSYLSVSNSNFTLNQASLNGNDVFIKCQDDFLVTNVRVNASLGISLYV
WARSFQAYQLNITGNSSLIQQNQLNQMKGVYLFQTPSSIVQDSYFSNLFSIKGSALNIVN
LLNQQVMKTQIINTVFTTNQAQQGGALKIDGLTNTYIIDTNFYNNIAYYFNDTIGTGNGG
GIHYSCPLTFSYCSLQIVRCSFIDNQAEMDGGAIKFDQSEVSIDFQTQFANNYAIYGPDK
ASYPIHLYKTNSTNQSAISDFQNPNAFSSGFQKLVEDSYNFEAEVSGQKFEIYYALVDHY
GNIVLTANSSYARFSTFSSGVYLESGNQVSKNGYFNFTDFVVTINPGDTLQMMIETDSIP
DEWLEKARNLQLKSQRLRQLQQGQSLDLLNLNNSKGTVPVYAQFRKCKIGEIQDSNKCVP
CSYNKYSNVANITEGSVQCKECLQNSFCEGLNNVAPLSGFWRLTDISENFMQCPNAQACL
GGVVDGEINSNTGSCEVGYEGNLCLACSDGYARYGQSECVICQNNILYNVRAIVTIIITL
GMISLGIKNQLDNQGSQKDYSICLIKIFGNFTQTISIISLFQLQWPSSVGSVASINNQYL
AAPLQVFSMDCYFRGFGVSTSLVRVFITIVTPLVVMLSSIVFFCIYYSIKVGIKLYTDKD
YQKKLKNAIIITQLVIIFVFHPQIVTASFSLFQCQQLGDNANPQKFSQIEPQLKCFEGEH
LNWVKYLGIPSLVLWVFIIPLIMALALWKYKDIIDRPDIVATYGFITKGYRAEFFFWEIV
IMYRKSILVIGSIFWKLDPFLTGLNILLYLFFWLIIQQKFQPFLTGQLNKVEEYSLLTSV
FFIYFSLYFIVDQHGSVISILMIILLMVTYIGYYAYFGLVYSKQKIIEVTETITNLSQEV
KHPFLVVVFGRLAEIKILSCAKNWFLEQKELVQAAILRQKVQQDEKLNKEIQNCSNQHVV
KDQIKEVVQQQSISQISQQDVFLQIKKKNKELFQAAQKFTDILLKKNEKIQINDKLKNLA
KKVRQKKEDHDDMIPLNQDFQNAKEITIQEEQNSFEDEGNINI


>TTHERM_00703530(gene)
ATGAATTTTCATTCTTATTTGTCACTCAAACCTATAATAATTCTTATAATTGTACATTAA
ATGCTCAGTTTTTTTAGAATTGTTTTGGCTGATGGGACTTGCTCTTAAACAGGTTGCATT
TCATGTCCTCATGGATAAGAAGCTTGTTATTAGTGTACTACGAGTTTTGTATTAATAAAC
TATAATTGCTTACCTATCGCAGCTTAATCTGTAATCTCCTACTTTGCAGTCCAAGATGGA
AAAGGATGTAAGCTATTTTTATTTTTTTTTAAATTTATTTTAAATACTGAAATAACCTAA
CAAATTAATGAATAAATCAATCAATCCTTTTATTTCTACTTCAAAAATATTTGTCAATTA
AATAACATAAAACTTAATAGAGCTGGTTTAGTACTCTGAAATTTGCCCCGAAGAAACAAG
TTACATCGATGACTCAGTAACTCCATCTCTTTGCATTCGTAAAAAAATTATATTAAAAAT
AATACGTTTTGTATAGAAAATAAAATTAACCAAATATTATTGTTATATTCTATTAATTTA
TAGCAATTTATTAATTAATAAAATAGCATGTCCTAGTTAATGTGATGGTTGCTTTCTACA
TGGATCCAGAAAAGTGTAATGCTGGGACTGTGCTTAGGGATATTATATGTAAAATTCATT
AAATTATTAAGAAGCAGACAGATATAGTTCTTCATGGAATCCAACTTGTGTTCGTAAAAT
TTATAATAATTTTTTAATAAATTTTTTATATTTTAACTTTCATTTAATCAAAAGAAATAA
ATTAAGCACAAACGTTAAATTTAGTAATCACAATCACTACTACAGTTTAAAACGCTGAGC
TTTAATCAATTCCTAATTACAATTGTGCTAGTCAATCTTTAACTTTTGGCAGTTTCTTCA
CTGCACTATTATTTGTTGAAAATGTGTGCTCTCAAAAGTATAGCTAAGGACAACTTACAT
TTACCTTTTAGAACGGTAATCATTTTATTATGATAGATAATGTTGCCTACTCTGGTAAAG
AAACTGATCCTGACTTTGTTTTCGAATTTTTCAGAAATTCTAATTATGATATAACTATCA
AGTAAATATTTTATGTTTCTAATTTTTTAACTTTAAAATTAATATTTAAAAAATTCAAAA
TAATTTTTTCTTTTCTGTCTTTCATAAAATAAATAAAAAATAAAATATTGATAATAAATT
ATTGATTTTTAAAATCCTAAAAGTTCTGCTTCAAGTAAAAACTAGGTGATTCTATACTGG
AGAACTGAAAAAATTAGATTTTATATCTTTGGTACTTTGAATTTATCAGGAGTTACAATT
GATGGAAGTGAAAACAAACTTTATTGTAATATAATTTATTAATTTTTGATTATTATTAAT
TATTTAAAATCTCTTTAATGAATCAGCTAATTTGAGTGATCCATCTAAATGCTTCACATA
AAGAAACTTATGCTGCAATGGAGCTACACCTCAAAATTATGTATGTAATAATGGTCCAAA
AAGATAATATAGAGCGACTGGAAAAACTTATCAGCCTGATGCTGTTGGTATGGGTTTATT
TAATTTTATGTCTTCTAAAAGATACACAGATACTGTCATACCTTCTATAACAATTAATGT
AAAAATATATATTAAAAAAAATTAAGTATAAGAAATTTTAATTTAGGCTGTTGATGTACG
CAATATGATGATGTTTTATCCAGACGGTATAAGATATTTCATAAAAATCCATTCTAACTA
TGGTTTTATCAGCTTAAGTAATGTTAATGTAGATAAATATTATTTCACTGGAGGTTTAAT
CTCTAATTATAGATATGTATAACCTAAAAGAGAATCTTATAGTTATATCGATTAAGACAT
TGGATTATAAAGGAGGTAAATAAACTTACTTAAAATTTTATTTTTTAAAATAAATATTGA
ATAATAAAAAATTATTTAATAGAACTGATTGTAGGATGCAAGTTGCAAATTTAAAATAGG
GGACTTTTTGTCTTCTCATATATTTAACATCTTCAACTTTTCAAAACTATAACTATGAAA
AATATACACGTTTATTTTTAGATTATACTGATAATCCAAAATTTATAGAGAGTTATACCC
TACATCTGTTTTCCACTTTAGCTTCAGTTAATATCTCGTAAAGTAAATTCCTTAATGCAA
TGGTATCTTCAACTATGGTTGATGCTGACAAAGAATTTTTTATAAGTTCTTAGGTTATGT
AGTGCAAAAATAGTTATGATTAAAGCTCAGAAAGTGACTTATTAAAGTCATCTTATCTTA
AAACAAATCCCAATCAGCACTTTGATTAGGATAAAATCTCTTAACACACTTAAATGCTTG
GTTCGCACATCGTTTGGTAATACATTAAAGGAAAATTATTAATGGATACTAATACATTCG
ATTCGAATATAGGCTACTAAAATCCTGCTATTTCAATGATGGGTTATTCCTAATATATGG
GAGCAAGTTTATAAACCTCATATATAATACTTGATTCAAATGGTAACTTTGCTTATGTAG
CAAATGCTGTTATATTTATACAAAATAGTATATTTACCAATAATTTTGCGTTTGTTGCAA
ACAGCGTAATGTCTTTTTACTAAAATTAAAATTCTAAGCCTTTTAATACTGGCTATATGA
GTTGTATGGGAATGAAGTTTCTATCTAATACATTTTAGAATAATTTAGGGTGTCCTACAA
GCTATTTTGTTGTTAGTATAAATTGCAGATTCTAAACTTTAACTTCATCATTTGCTAATA
ATTGGTACTAAGAACTTAATCCAACAAATACTTAGTAAGAAAATAATGATCTTCTCACAT
AAGTTGTATTTAGGTCTAATAAATTCATACAAAATTATGCAATTATATCAAATAGTCTTT
TTATAACTGGTGCTAGAGATATTAACATTGACTAAAATACTTTTGATAGTAATGGAGTAT
TGATAGATTAAACCAAAGTAATTTTTGTTAATTTAAATTTATTTTTATAAAACCTAACTT
ATTAAATAATTATAAAAGGGCTAGATTAACACTAATAACAACCCTTACATTAATATAGTA
AATTACAATAAGGCTACTTATCCATACTTTAATACTAATTGGATGACTGAATCATCAGCT
TTATTCTTGCAATATCCTGTTTCAACTTTTATAACAAACAACATATTCACTCAGAATTGG
GCCTTATCTAGTGGTGATAGTTATATTGGTTAATCAGTTATGCTTCATAAAATAGTTTCT
GTTACTGATGTAAAAATAAATAAAAAATTAATAAATTTAATATACTCATTTATTTAAATA
ATATTATAAATTAGGTTAAAATTTACAATAATTAATTTTTAAACCACAACGGACTACCTT
CAAGTTTTATTACTCAAGGCTCTTAAATAGGATGTAAAATATTAAAATTATTTTTAGAAA
TTGTTAAATAAAATTAATTAAAAATGATATAGAAGCTTACTCAACTCTGCCAATAATTTC
AGTGAATTTGTATACAAATTACCATCTTGCTAAATCAATTAGTGTTGCTATACAAATTGA
TTTCTATTAGAATACTTTTGCAAACAACTAATACAAAATTAATACTAATAATGTAGATAC
ACAAAATATAAAATATAAAACCTACACTCTATATTCGTTAGGAGGTTTTGTTCAGCTCAT
AAAACTATTTACTGATAATGAGGTTCTAGGTTCACAACCTGTTTCAAATGATTATTTATA
TATGATGTATAGTCAAGTCAATTTCTTAATCAGAAACTCAAATTTCACTCAAAATACAGT
AATTATTTTACCTACATTTTAATTTTATAAATTAAATATTTTTTTTTAGCATTATAATGG
CGGTTGCCTAATTGAAGTTTCAGGACTAAATTAACTATAAGGGTACGGCAATACATTTTC
AAGTAATAACAATGACTTCTAATCAGCGATAAATAATTAAATTGGAGGAATGATTTGCAT
GCTTCAAAGTAGCCCTGTAACTCTAGCTAACACTACAAATAATGAACCTATTCTTAATCT
TATGCAATCAACAGTTACAGGTGACAAAGGAATTCATGTTTAAAACTAGCTAGTCGGTTC
TTACATTGAAATAGGAGACATGAATTTTATTGGGTTCTAATCATCGAATTCAATTTTAAT
TTCATCAGTAAATCAATTTAGTTTTTATTTAAATTAAAAAATATAAACTTTTAAAATTGA
TAAATAAAAATAATTATTTTTACCAGTAAAATTGCTGATATTTATTTTGAATTTAATAAA
TAAACTAAATTAAATTTGATTGAGAAAAAATTAAAAATATTTATAAAAATAGGATTCAGG
CTAGGTAAATATGGAAGGTAACTTATTTAACAGTTCAGTAGCAATAAATGGATTGATGAG
CTTTAAAAGAGTAGGAAAACTTATTCTTCAAGATTTACAAGTTTTATAATCGTTCCCTTA
CACAATATATCTTGAGAGCGCATACAATTATTAGCTGAATGGATTAACAATTTAAAATAA
TAATTTGAATTTATTCTCTAGTTACATCTTATCTAAAATGAACTAATAGGATTATACAAA
TTTGATAAACAGTGGAGTACAGGTTTTGTATTTATACAGATCAAGAGGTATAATGCTCAA
CAGTAATTTTAATAATAATTTAGTTTCAAGTGCTTCTGTAGCCTTATTAAGAGATAACAG
TTTACTCACAGCTACAAATCTAAATGTTACAAATAACCTTGCTTAAAATATTGGAAGTAA
TTTTTATGTCACAGATACTTCAGTTCTCAATTTAGTTCTCTCCAATTTCTAGAATAACAC
TTCTTTGCTAAACGGAGGATGTTTCTTTATATAAAACTCTTATTTTAGCATTAGTTAAAC
AAATGTTTCATTTTGTTAATCAAAATAAAATGCTGGAGTTGGAAGAATAGAGCAGTCTAT
TGTAGATATTAGCAACTCAACATTTTAAAATAACACTGCTCTTCAAGAAGCAAGTTTGTT
ATATTCAATTAGTTCAGACATAAATATCAAGTTTTCAAAATTTTTCAATAACTCAGCTAA
TTCGTGTGGTATTATAGCAAGTACTGTAAATCTTTTCATCCTTGGTTCCAATTTTACTGG
GAATAGTGCAAATATAAAAACAAAGAATATATATGCCACATAATCAACTCTTTAACTATA
AGACTCTTTTTTCAATGATACTCAGCCAATCAATCAGGTAATTAATCTTTGTATGTAACT
TAAAAATATTTATTTAATTAAAATTCATTTTAGGTTTCAGGGGCATTCATTTAGTTATTT
AAAAGTACAGGCTAAATATCTTCATCTCAATTCTATAATGGTTAATCAAACTATGGTGGA
GCAATTATGGTTGAGGCTTTTTCTGATGTTCAAGTAGATTCTTGCTTATTTAATAATAAT
TATGCTGTCTAGTCTGGTGGAGCTATAGCAAGCTCTAGTTATTTATCAGTATCTAATAGT
AACTTTACTTTAAATTAAGCCTCTCTTAATGGAAATGATGTATTCATAAAATGCTAAGAT
GATTTTCTAGTCACAAATGTAAGAGTCAACGCTTCATTGGGTATCAGCTTGTATGTTTGG
GCTAGATCATTTTAAGCTTACTAGCTTAACATAACTGGTAACTCTTCCCTAATTTAATAA
AATTAACTAAACTAAATGAAAGGTAACTTATTAATTAAATTAATATACTTTAAAATGAAT
ATTAAATTTATTATAAAAAAGGTGTGTACTTATTTTAAACTCCATCATCTATAGTATAAG
ATAGTTATTTCTCTAATCTATTCTCGATAAAAGGGTCTGCACTCAATATAGTAAACTTGC
TAAACTAACAAGTAATGAAGACACAAATAATCAATACTGTTTTTACAACAAACTAAGCAC
AATAAGGAGGAGCTCTTAAAATAGATGGGTTGACAAATACTTATATCATAGATACTAATT
TCTACAACAATATAGCCTATTATTTTAATGACACTATAGGAACTGGTAATGGAGGAGGCA
TACATTATTCATGTCCTCTTACCTTCAGTTACTGCTCCTTGTAAATTGTTAGATGTAGTT
TTATCGATAATTAAGCTGAAATGGATGGAGGTGCTATCAAATTTGATTAATCAGAGGTCT
CAATTGATTTTTAAACATAATTTGCTAATAACTACGCCATATATGGACCTGACAAAGCAT
CTTATCCTATACATCTCTATAAAACTAACAGTACCAACTAATCAGCAGTAATATTTTATT
TAGCTCCTATTTTTATTTGAAATTATTGTTTTTTTTAAATAAAAGATTTCTGATTTTTAG
AATCCAAATGCTTTTTCTTCTGGATTTCAAAAATTAGTAGAAGATTCTTATAACTTTGAA
GCAGAAGTATCTGGCTAGAAATTCGAAATATATTATGCTCTTGTTGATCATTATGGAAAC
ATTGTCCTAACTGCTAATTCATCTTACGCCAGATTTTCTACATTCTCATCGGGAGTATAT
TTGGAGAGTGGAAATCAAGTTTCTAAAAATGGTTATTTTAACTTTACAGACTTTGTCGTT
ACAATAAATCCAGGAGATACTTTACAGATGATGATAGAAACGGATTCTATTCCAGATGAA
TGGTTAGAAAAAGCTCGTAATTTACAGCTTAAGTCTTAGCGTCTGCGCTAATTATAGTAA
GGATAGTCTTTAGATTTATTAAACTTAAATAACTCAAAAGGAACAGTCCCAGTATATGCT
TAATTCCGTAAATGTAAAATTGGAGAGATTTAAGGTAAAAAAATATATTATCTTTAATTA
CATTCTTATTTAATCTTAAATAATCTTTGTTTCATAAAAAAATATTAAAATAGATTCTAA
TAAATGTGTACCTTGTAGTTATAACAAATACTCCAATGTTGCTAATATTACTGAAGGTTC
AGTCTAATGCAAAGAATGTTTATAGAATGTAAATAATAATAAATATTTAAAAAATATTTA
ATTTCTAAATTTTAAATAAAGTCATTTTGTGAAGGACTCAATAATGTAGCTCCTCTTTCA
GGGTTTTGGAGATTGACAGATATAAGCGAAAATTTTATGTAATGCCCTAATGCATAAGCC
TGCTTAGGTGGAGTAGTTGATGGAGAAATAAATTCAAATACTGGTTCTTGTGAAGTTGGT
TATGAAGGAAATCTTTGTTTAGCATGCTCTGATGGTTATGCTAGGTTTTGTTTTGTTTTA
TTTAATTTTATTTATCAAATAATATTTTTAATTTAAGCTTAAAAATTAAAAAATTAAAAG
AATTAAAAAATAATTAATTTTTATAGATATGGATAATCTGAATGTGTAATTTGTTAAAAT
AATATTCTGTACAACGTTAGAGCCATCGTGACAATAATAATTACTTTAGGAATGATTTCT
CTTGGTATTAAAAACTAATTGGATAATTAAGGTTCATAAAAAGATTACTCAATTTGTTTG
ATTAAAATATTTGGAAACTTCACTTAAACTATTAGTATTATTTCTCTATTTTAGTTGTAA
TGGCCTTCTTCTGTTGGTTCTGTGGCTAGTATCAACAATTAATACCTTGCAGCACCATTA
CAAGTGAATTTTAAATTATTATTATTATTAGTATAAAAAAACTATTTAATTTTTTTATAA
CTTAAGGTTTTCTCTATGGATTGCTATTTCAGAGGATTTGGAGTTAGTACTTCTTTGGTA
AGAGTATTTATTACTATTGTTACTCCTTTGGTTGTTATGCTTTCATCAATCGTTTTCTTC
TGCATTTATTATTCGATAAAAGTAGGAATAAAGCTCTATACAGATAAAGATTATCAAAAA
GTAATTTCTAATATATAATAAATAAAAAAATATTTTTATTAATTAATTTAAAAGAAACTT
AAAAATGCAATCATCATCACCCAGCTAGTCATTATTTTTGTATTTCATCCTCAAATTGTC
ACAGCTTCGTTTTCTCTATTCTAATGCTAATAATTAGGAGATAATGCAAATCCTTAAAAG
TTTTCACAAATAGAGCCTCAGCTTAAGTGTTTTGAAGGCGAGCACTTAAATTGGGTTAAA
TATCTTGGTATACCTTCTCTAGTACTATGGGGTAATATAATATAATTCAATTAATTTAAT
AATAAATTATCTAAAATAATTAAAAAAGTTTTTATTATTCCCTTAATCATGGCTTTAGCA
TTGTGGAAGTATAAAGATATAATAGATAGACCTGATATTGTTGCCACTTATGGATTTATT
ACAAAAGGTTACAGAGCAGAGTTTTTCTTTTGGGAAATTGTTATTATGTATAGAAAATCT
ATACTAGTCATTGGAAGCATATTTTGGAAGTTAGATCCTTTCCTAACAGTATTTTAATAT
TTTAAGTTTTTTAATAAAATGATTTGAAAACTATAATATTTTCTTAATACCTTATTTTTT
AACTAGGGTCTAAATATATTACTCTATCTTTTCTTTTGGCTAATAATTTAATAAAAATTC
TAACCTTTCTTAACTGGCTAACTAAATAAAGTGGAAGAATACTCTTTACTCACATCTGTA
TTCTTCATCTACTTTTCTCTTTACTTTATTGTTGGTAATTAATTTAATTTAAAATATTTA
TTACATAAATATATTTTCTTCTAATATATTGTATTAATAATTGTGATATAACTTATAAAT
ATAGACCAACATGGATCAGTGATTAGTATTTTGATGATAATTTTGCTTATGGTTACTTAT
ATTGGATATTATGCATATTTTGGCTTGGTTTATTCTAAATAAAAGATAATTGAAGTCACA
GAAACTATTACAAACCTTTCTTAAGAAGTCAAACATCCATTTTTAGTAGTTGTATTTGGC
AGATTAGCAGAGATAAAAATTTTATCATGTGCTAAAAATTGGTTTTTAGAGCAAAAAGAA
CTTGTTCAAGCTGCTATTTTAAGATAAAAAGTCCAGCAAGATGAAAAACTAAACAAAGAA
ATCTAAAATTGCAGTAATTAGCATGTAGTTAAGGATTAAATAAAGGAAGTAGTTTAATAG
TAGTCAATAAGTTAAATTAGCCAATAAGATGTCTTTTTGTAAATAAAAAAGAAAAATAAG
GAGCTATTTTAAGCAGCTTAAAAATTCACTGATATCCTATTAAAAAAGAATGAAAAAATA
TAAATTAATGATAAGTTAAAAAATTTGGCAAAGAAGGTAAGGCAAAAAAAAGAAGATCAT
GATGACATGATACCTCTTAATTAAGACTTTTAAAATGCAAAAGAAATTACAATATAAGAG
GAATAAAATTCTTTTGAAGATGAAGGAAATATAAATATTTGA