Identifiers and Description

Gene Model Identifier

TTHERM_00703400

Standard Name

None

Aliases

PreTt20116 | 110.m00089

Description

Protein kinase domain containing protein. Sequence similarity to the CK1 protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00703400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15316.19.997093137033517e-262CRAL/TRIO domain-containing pr
otein (919 aa)
OxytrichaContig6518.0.g543.999751664085691e-132Protein kinase domain
SGDYPL204W1.9990002532767049e-131HRR25 Protein kinase involved
in regulating diverse events i
ncluding vesicular trafficking
, DNA repair, and chromosome s
egregation; binds the CTD of R
NA pol II; homolog of mammalia
n casein kinase 1delta (CK1del
ta)
DictyBaseDDB_G02730599.00380424774434e-131cak1-1 on chromosome: 2 positi
on 2688821 to 2690431
WormBaseWBGene000022036.001815994751712e-130locus:kin-20 Casein kinase I
isoform delta status:Confir
med UniProt:Q20471 protein
_id:CAD56585.4
Stentor CoeruleusSteCoe_86971.1677812485237086e-60

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00703400(coding)
ATGGAAGTTAGGGTCGGAGGAAAATTTAGAGTAGGAAGAAAAATAGGAGCAGGCTCTTTT
GGAGAAATATATTTAGGCACAAACATCCAAACAGAAGAAGAAGTTGCGATTAAGCTTGAG
TCAGTAAAGACAAAGTTTCCATAGCTTTAATGGGAATACAAAATTTATAAAATATTGCAA
GGACAATTTGGAATTCCTAATCAGCACTGGTATGGCAGAGATGGCGATTATAATATACTT
ATCTTAGATTTATTGGGACCATCTCTCGAAGATCTCTTTTAGTTATGCAATAAGAAGTTT
TCTTTAAAGACAGTATTGATGATAGTTGAGCAGATTATTTCTAGGATAGAATAGATACAC
GCAAAAAATTTCATATATAGAGATATAAAACCAGATAATTTCTTAATTGGAACTAAATAA
AAAGCTGATCACATTTATTTGATTGACTTCGGTCTAGCAAAAAGATACAGAGATGCTAAA
ACAGGCTAGCATATAGAGTAAAAGGAAGGGAAGTCCTTTATAGGAACTGTTAGATATTCT
TCTATAAATACACATCTTGGAAAAGAATAAAGTAGAAGAGATGATCTGGAGGCTATAGGA
TACATTCTCTTATATTTCTTAAGGGGATCTCTTCCTTGGTAAGGAGTTAAAGCTGACAAT
AAAAAGGATAAGTATGATAAGATAGGTGAAATTAAAATGAATACTCCTGTAGAGGAATTA
TGTAAAGGTTTTCCAGATGAATTTGCTCAATATATAAAATATACAAGAGATTTAAAATTT
GATGAGAAGCCTGATTATAATCAGATTAAGTAATCGTTTAGAGCTCTTTTTTATAAATTA
GAATATAATAACGATAATATTTTCGATTGGTCTAAGTTAAATTCAAATAATGTGCATAAA
AAGAAAGAAATAGAATAAGAAAAAGATCAAACAGAAGATAACACAGGAAACGACATTAAG
GGTGAATCTTCGAATAATATTCCTCAATAGGCTAATTAAATTTATAAAAGTAACCAAATG
ATACCAAGTACCAATAAAATTCCTCCTTAACACAATAATGTGATTTAAAGCAATAAATTA
TCTAATAATAATGGAGTTGGTACTCCTAATAATAAATTAAACCAAGTAAAATAAAATCCT
GTTGCGAAAATGAATTAACCAAAGTAAATTAATAATACTAATCCTAACAAAATAAACATG
AACAAGGTAAATAGCGGAAATAACTCAAATGTAAATAGTCCTATGAATAATAATGTAACT
AATTCTAATAAAGCAGTAGACAAGCCTAAATAGCTTGCAACTAATAGTATGTTTTCGAGA
GCTATTGGAGATATCTAAAAATAATAAGCGAATCCTAAAAAATGA


>TTHERM_00703400(protein)
MEVRVGGKFRVGRKIGAGSFGEIYLGTNIQTEEEVAIKLESVKTKFPQLQWEYKIYKILQ
GQFGIPNQHWYGRDGDYNILILDLLGPSLEDLFQLCNKKFSLKTVLMIVEQIISRIEQIH
AKNFIYRDIKPDNFLIGTKQKADHIYLIDFGLAKRYRDAKTGQHIEQKEGKSFIGTVRYS
SINTHLGKEQSRRDDLEAIGYILLYFLRGSLPWQGVKADNKKDKYDKIGEIKMNTPVEEL
CKGFPDEFAQYIKYTRDLKFDEKPDYNQIKQSFRALFYKLEYNNDNIFDWSKLNSNNVHK
KKEIEQEKDQTEDNTGNDIKGESSNNIPQQANQIYKSNQMIPSTNKIPPQHNNVIQSNKL
SNNNGVGTPNNKLNQVKQNPVAKMNQPKQINNTNPNKINMNKVNSGNNSNVNSPMNNNVT
NSNKAVDKPKQLATNSMFSRAIGDIQKQQANPKK


>TTHERM_00703400(gene)
ATGGAAGTTAGGGTCGGAGGAAAATTTAGAGTAGGAAGAAAAATAGGAGCAGGCTCTTTT
GGAGAAATATATTTAGGTACTAAATCAATGTTTAAAATCTAATTATGTTGCATTACGCTA
GTTTTTTGCTGATATCTAAAGCGATTTTATATATTTTCTTCTACTAAAATTAACAATAAA
TCAATATTTTTACTTTCATATTTCGTTCTACAACAAGCTTTTAAATGAATAAGTTATTTC
GATTCCACATTTAATTTACTATTTTTAAAAATTCATTAGGCACAAACATCCAAACAGAAG
AAGAAGTTGCGATTAAGCTTGTATATTTTTATTTTTTAAAGCTTTCCATTTAGCTATTAA
GTAAATCTTAAAAATGATTCTAACAAAAAATTATAAATAAAAAGGAGTCAGTAAAGACAA
AGTTTCCATAGCTTTAATGGGAATACAAAATTTATAAAATATTGCAAGGACAATGTAAAA
ACCATTTTTTTATTAGAATATTTCTTTATTTATTTAAAGCAAGTTTACTATCAATTTTTC
TTAGGAGCTACAAATATAAATATTTATTGCACAAAATTATGCATTTAGGAAAACCATTAA
ATAACTTAAAAAACAATTTTAATAAAAATGACATAGAAATGTTTATTATTTTAATTCGTT
TATTATGTAAAATGTTAGTTGGAATTCCTAATCAGCACTGGTATGGCAGAGATGGCGATT
ATAATATACTTATCTTAGATTTATTGGGACCATCTCTCGAAGATCTCTTTTAGTTATGCA
ATAAGAAGTTTTCTTTAAAGACAGTATTGATGATAGTTGAGCAGATTATTTCTAGGATAG
AATAGATACACGCAAAAAATTTCATATATAGAGATATAAAACCAGATAATTTCTTAATTG
GAACTAAATAAAAAGCTGATCACATTTATTTGATTGACTTCGGTCTAGCAAAAAGATACA
GAGATGCTAAAACAGGCTAGCATATAGAGTAAAAGGAAGGGAAGTCCTTTATAGGAACTG
TTAGATATTCTTCTATAAATACACATCTTGGAAAAGGTAATAATCCTTTAATTTAATTAA
GAACACCTTTACCGATAGAATAAGAGGATAAAATTAAATCAAAAAAAATTAATTAGTTAG
TTAGCTTTCTTAAATTTAAAATATTTTTAATATTTAATTTGTATTCTTTAATAAAAGAAT
AAAGTAGAAGAGATGATCTGGAGGCTATAGGATACATTCTCTTATATTTCTTAAGGGGAT
CTCTTCCTTGGTAAGGAGTTAAAGCTGACAATAAAAAGGATAAGTATGATAAGATAGGTG
AAATTAAAATGAATACTCCTGTAGAGGAATTATGTAAAGGTTTTCCAGGTAATTTTAAAA
AGTTCAAAGATTTTAGCAAATATTCAAATAATTTTAATGAATAAATATTTTAATAAATTT
AAGAATTATTCAAGGAATTTGAATAAAAAAAGGTTATTTACAAAATTAAACTATTTATTT
TTTCAATAATTTAAAAATAGATGAATTTGCTCAATATATAAAATATACAAGAGATTTAAA
ATTTGATGAGAAGCCTGATTATAATCAGATTAAGTAATCGTTTAGAGCTCTTTTTTATAA
ATTAGAATATAATAACGATAATATTTTCGATTGGTCTAAGTTAAATTCAGTAATTAAATT
TTCTTAAAAATTAATTATTTTCAACAAATAAGCAAATAGATTTAAGTAGTTATATTATTG
TTTAAATTAATACATAGAATAATGTGCATAAAAAGAAAGAAATAGAATAAGAAAAAGATC
AAACAGAAGATAACACAGGAAACGACATTAAGGGTGAATCTTCGAATAATATTCCTCAAT
AGGCTAATTAAATTTATAAAAGTAACCAAATGATACCAAGTACCAATAAAATTCCTCCTT
AACACAATAATGTGATTTAAAGCAATAAATTATCTAATAATAATGGAGTTGGTACTCCTA
ATAATAAATTAAACCAAGTAAAATAAAATCCTGTTGCGAAAATGAATTAACCAAAGTAAA
TTAATAATACTAATCCTAACAAAATAAACATGAACAAGGTAAATAGCGGAAATAACTCAA
ATGTAAATAGTCCTATGAATAATAATGTAACTAATTCTAATAAAGCAGTAGACAAGCCTA
AATAGCTTGCAACTAATAGTATGTTTTCGAGAGCTATTGGAGATATCTAAAAATAATAAG
CGAATCCTAAAAAATGA