Identifiers and Description

Gene Model Identifier

TTHERM_00693080

Standard Name

CYC17 (CYClin 17)

Aliases

PreTt02891 | 107.m00071 | 3753.m00365

Description

Cyclin; N-terminal domain containing protein; the only meiosis-specific cyclin with a complete cyclin core; essential for anaphase initiation and chromosome segregation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00693080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18399.13.0009061039838537e-46hypothetical protein (748 aa)
OxytrichaContig19198.0.1.g269.99967697349061e-30Cyclin, N-terminal domain
SGDYPR119W4.998021988471165e-24CLB2 B-type cyclin involved in
cell cycle progression; activ
ates Cdc28p to promote the tra
nsition from G2 to M phase; ac
cumulates during G2 and M, the
n targeted via a destruction b
ox motif for ubiquitin-mediate
d degradation by the proteasom
e
DictyBaseDDB_G02754933.0007793728221555e-22cycB on chromosome: 2 position
6000211 to 6001649
WormBaseWBGene000008661.000116773704384e-19locus:cyb-2.1 status:Partial
ly_confirmed UniProt:O45926
protein_id:CAA15975.2
Stentor CoeruleusSteCoe_218250.000000000000001713908431542013

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27192402: Yan GX, Dang H, Tian M, Zhang J, Shodhan A, Ning YZ, Xiong J, Miao W (2016) Cyc17, a meiosis-specific cyclin, is essential for anaphase initiation and chromosome segregation in Tetrahymena thermophila. Cell cycle (Georgetown, Tex.) 15(14):1855-64
  2. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  3. Ref:SUPR000113

Sequences

>TTHERM_00693080(coding)
ATGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAAT
TTCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAA
AAAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGA
ACCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAAC
TATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGAC
TTCAACTTACTTCAAGACGATCAAAATAAAGAAAATGTATTAACATTTTAGCACAATTTT
CAGAGTGAAGTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAA
TTAGCTTAATCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCA
TCAGAAAGTTAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGT
ATGATTGAGTAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAA
GAATTTCACATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAA
ATTAATTTTTTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAA
GAAATATTCGAATATTTGTAAGCTCATCAAGAGAGATATTTATGTAAAGATAACGTAGAC
CTAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTT
ACTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATG
CTAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTAT
TAAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCT
GGAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGC
ACAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACA
TTTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGGATTA
TTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCAGTCCAATGTACGTTAAATCCTCA
ATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCGTTGCTGAAAATATTTGGGACGAA
AAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACCCTACTTCTGATTTTTAATTCTTA
ATGCCAAGCATCCATAAACTAATTTAACTTTATTCGAATCCTTAGTTTCCTTTTGAGGCA
ATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAGTTTCTACCACTTTTACCTAAAAC
ATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTTAACAACTAACCAATATTTGA


>TTHERM_00693080(protein)
MWESKIEHNRRSQHFLSQNNFQDKKENIQQPPFKNYVLGEKTQKVQQINQLETQEFQQRG
TNKHRVFGRVINENGVNSNNYFHSQPLQKQFKVFNPFAQDFNLLQDDQNKENVLTFQHNF
QSEVHKNQQTKNINQEINKELAQSEKSFQMIDESEKINSSSESQLIQNILNLDLLNTSQS
MIEQNQNQLINFCQENDKLKEFHIINETNYNTLKSTQIEKINFFDRQFISNPIYVAEYAQ
EIFEYLQAHQERYLCKDNVDLKDMHTQINETMRCILIDWLTEVSIKYELKEETIFMCIYM
LDIYCRLCYQDGIQILRDHYQKIGVSCLYISSKLEEIYPPGVKEFVKICDGAYKLKDIIS
TETDICLKLQFNFSFPTPFTFFVRYSKILGHSNLQYYQGLFILYLCFMHSELSPMYVKSS
IIASCSCFLVESVAENIWDEKIKSLSSIVYLHPTSDFQFLMPSIHKLIQLYSNPQFPFEA
IRKKFSSDSFCKVSTTFTQNISDSQKNSQQQSQQLTNI


>TTHERM_00693080(gene)
ATGGTAAAATAATTTATAAGAAGTAGAATGATTTCATTTTTATTTATTTTAATATTGCAT
AGTGGGAGAGTAAAATTGAACATAATAGGAGGAGCTAACATTTCCTATCTTAAAATAATT
TCCAAGACAAAAAAGAAAACATTTAGTAGCCCCCTTTCAAAAACTATGTTTTAGGAGAAA
AAACATAAAAAGTACAGTAAATTAATTAATTGGAAACACAAGAATTCCAACAAAGAGGAA
CCAACAAACATAGAGTATTTGGAAGGGTCATAAATGAAAATGGAGTAAATAGCAATAACT
ATTTTCATAGTTAGCCTTTACAAAAGCAATTTAAGGTTTTTAATCCGTTTGCTTAAGACT
TCAACTTACTTCAAGACGATCAAAATAAAGTAAATAAAATTTACTTCTAAGAAGCACTTT
TTAAATATTTAAAAAATATAGGAAAATGTATTAACATTTTAGCACAATTTTCAGAGTGAA
GTTCATAAAAATCAATAAACGAAGAATATTAATCAAGAAATTAATAAAGAATTAGCTTAA
TCTGAAAAAAGCTTTTAGATGATTGATGAGAGTGAAAAAATTAACTCCTCATCAGAAAGT
TAATTGATATAAAATATTTTAAATCTTGACCTTTTAAACACTTCTCAAAGTATGATTGAG
TAAAATCAAAACTAATTAATTAATTTTTGCTAAGAAAATGACAAATTGAAAGAATTTCAC
ATTATCAACGAAACAAATTATAACACACTCAAAAGTACTTAAATAGAAAAAATTAATTTT
TTTGATCGATAATTCATTTCGAATCCAATTTATGTAGCTGAATATGCATAAGAAATATTC
GAATATTTGTAAGCTCATCAAGTAAACAAACAAATAAACTTACTTAAAATAGCTTAAAAT
TTTTAATTGTTTTATTTATTACATAAAAGGAGAGATATTTATGTAAAGATAACGTAGACC
TAAAAGACATGCATACTTAGATAAATGAAACTATGAGATGTATTCTTATTGACTGGCTTA
CTGAAGTTTCCATAAAATACGAATTGAAAGAAGAAACCATCTTCATGTGTATATACATGC
TAGATATCTATTGCAGACTATGCTATCAGGATGGAATACAAATATTAAGAGACCACTATT
AAAAGATTGGTGTTTCTTGCTTGTATATTTCAAGCAAACTAGAAGAAATTTATCCTCCTG
GAGTAAAAGAATTTGTTAAAATTTGTGATGGAGCTTACAAACTAAAAGATATTATAAGCA
CAGAAACAGATATATGCCTAAAATTATAATTTAACTTCTCCTTTCCTACGCCATTTACAT
TTTTTGTAAGATATTCTAAAATTCTAGGTCACAGTAATCTGCAATATTATCAAGTTAATT
ATTTCATTTAGAATAAATTTTTCAACTTATTACTTACTAAAAAACTAATAAAAACTATTT
TAATCTTTTTAAAATAGGGATTATTTATCTTGTATCTTTGTTTTATGCACTCTGAACTCA
GTCCAATGTACGTTAAATCCTCAATAATTGCTTCTTGTAGTTGCTTTTTAGTTGAAAGCG
TTGCTGAAAATATTTGGGACGAAAAAATTAAATCTCTTTCCTCAATCGTCTACCTTCACC
CTACTTCTGATTTTTAATTCTTAATGCCAAGCATCCATAAACTAATTTAACTTTATTCGA
ATCCTTAGTTTCCTTTTGAGGCAATTAGAAAAAAGTTTTCATCTGATTCATTTTGTAAAG
TTTCTACCACTTTTACCTAAAACATTTCTGATAGCTAAAAAAATTCCTAATAATAATCTT
AACAACTAACCAATATTTGA