Identifiers and Description

Gene Model Identifier

TTHERM_00691880

Standard Name

None

Aliases

PreTt03026 | 106.m00166 | 3674.m00079

Description

tetratricopeptide repeat protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06994 ) Involucrin
  • ( PF08238 ) Sel1 repeat
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR02795 ) tol-pal system protein YbgF
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( TIGR03302 ) outer membrane assembly lipoprotein YfiO
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00691880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17554.19.997093137033517e-262TPR Domain containing protein
(846 aa)
DictyBaseDDB_G02882235.997798783616184e-81anapc3 on chromosome: 5 positi
on 1273822 to 1276819
SGDYBL084C2.000704504372864e-47CDC27 Subunit of the Anaphase-
Promoting Complex/Cyclosome (A
PC/C), which is a ubiquitin-pr
otein ligase required for degr
adation of anaphase inhibitors
, including mitotic cyclins, d
uring the metaphase/anaphase t
ransition
WormBaseWBGene000031323.000619078166531e-39locus:mat-1 status:Confirmed
UniProt:Q9N593 protein_id
:CCD66209.1
Stentor CoeruleusSteCoe_104241.3336148155022614e-34
OxytrichaContig4357.0.g882.0003218023735366e-33Tetratricopeptide repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691880(coding)
ATGGAGGAAGACGGTTAAAATACAAACTAGACTTTAATTCGCTAACTTATCGATTCTATT
GAAGATAATTTAGCCAATCATCTGCCTTCAAATGCTGTGTTTTTAGCTGAGAGGTTACTC
GCTGAATAAGATACAGAAGAAACACGCGGTATTTTAGCAGAGTGTTACATGGCTGAAAAC
AAGCATTATAAAGTTTATGATATCCTCAAGCTTTGCAAATCAGAAATGAATAGATACAGA
TTTGCTTTAGTTTGTCTTAAGCTTAACAAAAATCAAGACGGAGAAAAAGCTTTGTTAATG
GAAAATTACAACCCTTAGGATTAAAATATGTAATCTAAGCACAGGTCTTAAATGCTACCA
GACTACGTTCCTAACGGTTGCTATGGATTCTACTTACTTGGTTTAATCTATGAAGGATAA
TAGAAGTTTTAGGAAGCAAAAAATTATTTTGTGAAGGCGTTAGAATTAAATCCAACATTA
TGGGTAGCATATGAAAAGATTTGTAAGATTGGTGATTAAGAAATCCTACCTTACAAGATT
TTCTGTGAGACAAAATATAAATAATATATCAATTCAAAGAAGGCTAAAGGCTTGTATAGC
TTCAATCCATAAGTTAACTTTTTAAGAAACTTCAAAGAATCTGCTGGTTTTTATAATTCA
ACTGATGAGACTGAAGATGGAAATAGTTTAGCAAATCAAGTGGCAAATAAATAAAGAATA
CCTAATCAAGCTAAAGATCAGGGTCTTTAAAGAAATCCAGCTCAGTAAGCAATCAAACCT
GGAACATCAAATATTTCTACTATAGGATAAGTGACTGCAGGAAGAAACGATAGTAATTCA
AGAAATAATAGTGCAAAAAGGAAAAAATCAGGAAAGTTAGATAATGGTGTAGGCCTTTTA
AGCTCTATACCATCACAACCATCTAGTGGTAGCAGTAACATTTAAGGAGGGTAAAATAGT
TAATTAGGCGTAGGTTCTTAACAATTTCCTGCTGCCTCTTCTGCTAACTAATACATTCCT
GGTTAGATGGGTAATTCAAGTGTTTTGCAATTTGATTCCACATCAGCTACTTTATTAGGT
TTATAATAAAAGATGTCTTCTTCTGTTAATAATACAAGTACATCACAGCAATAGCAACAA
CAAATATTATCTTAAGGACTTAATTTGGGCATGAATAATCCTAATCAATTTATATCTGCA
AATAGCTAATTCTAAAATCTTTAAAATACTGTTAATTCGCCTTATATTGAATCTCGCTAT
GGTGGTAGTTAAGATTATTATTAATTTTAAAAACCTACTGCTGCTATGTAGTCTACTGCT
TATAATATTTATGCATAATAAGGAGGTGTTAATAAAAATTTACAAACTCCATAGATAAAT
ATGTTACTAAGCAATTAAATGAATTAGCACTAGCTTTAAAGTAACATTTAGCCTTTCTTT
GGAGCTCCTGGATTTTAGTAATAATTGAGTGCAAATGATTTTTCTTAATCTGTTTCCTCT
TCAGCAACTCCTATTAGAGATATTTGCACTCTTCTTAGAAGATTTGGTGAAGCCTTCTAT
CATATGTCACTTTACTTGTGCAAAGAAGCTATTGATTATTTCTTTAACCTTCCTAAAAAT
CATTAACAAACAGGTTGGGTTCTTACTCATATTGGTAGATGCTATATGGAAATTGTTAAG
TACAGTGAAGCTGAAAAGTATTATACTGAAGCTCTAAGAATTGAGCCTTACAGACTAGAA
GGAATTGAGTATTATTCTAGTTGCTTATGGCACTTGAAGAAGCAAGTAGAACTCTGTTAT
CTTGCCCATTAGGCTTTAGATAAGTCTTTATTTGCTCCAGAAACATGGATTGCAGTTGGA
AACTGCTTTAGTTTATAAAAGGAGCATGAAAATGCATTAAAATTCTTCTAAAGAGCAATT
TAATTGAATCAACAATCAGCCTATGCTCATGCTCTTTGTGGTCATGAATTTGTGTACAAC
GAAGACTTTGCTCGTGCTAGAAAATCATTCCAACAAGCTCTTAATCTTGATCTAAGAAAT
TACAATGCTTGGTGGGGACTTGGTAATATCTTTTATAAATAAGAAAAATACAATCGTGCA
GCTGAACATTTCCAAAATGCAATCAAAATTAATTAAAAAAATCCAGTGCTCTATTCATTT
ATGGGTATGACATTAGCTGCAGACAGAAACTATAGCTCAGCCCTTTAATATTTTGAATAA
TCAGAAAAGCTAGACCCTAAAAATGGATTAAATAAATTCTAAAAAGCCAACACTTTAGTA
AAATTAGAGAAATACGAAGCTGCCTTAAAAGAATTATAAGAATTAAATTTGATGATGCCA
AAAGAAGCCCCTATACCTATGCTAATGGGAAAGGTTTATAAAAAGCTTAATAAAACAGAT
CTGGCTTTGAAATACTTTACAGATGCTCTAGATTTAGAAAATAAAGATACCCAAAGAATA
AAAGCTTTAATAGAATCTCTGCATCAAGAAAATTAAGATTTTGGAGAAGACCTAGAAATT
TGA


>TTHERM_00691880(protein)
MEEDGQNTNQTLIRQLIDSIEDNLANHLPSNAVFLAERLLAEQDTEETRGILAECYMAEN
KHYKVYDILKLCKSEMNRYRFALVCLKLNKNQDGEKALLMENYNPQDQNMQSKHRSQMLP
DYVPNGCYGFYLLGLIYEGQQKFQEAKNYFVKALELNPTLWVAYEKICKIGDQEILPYKI
FCETKYKQYINSKKAKGLYSFNPQVNFLRNFKESAGFYNSTDETEDGNSLANQVANKQRI
PNQAKDQGLQRNPAQQAIKPGTSNISTIGQVTAGRNDSNSRNNSAKRKKSGKLDNGVGLL
SSIPSQPSSGSSNIQGGQNSQLGVGSQQFPAASSANQYIPGQMGNSSVLQFDSTSATLLG
LQQKMSSSVNNTSTSQQQQQQILSQGLNLGMNNPNQFISANSQFQNLQNTVNSPYIESRY
GGSQDYYQFQKPTAAMQSTAYNIYAQQGGVNKNLQTPQINMLLSNQMNQHQLQSNIQPFF
GAPGFQQQLSANDFSQSVSSSATPIRDICTLLRRFGEAFYHMSLYLCKEAIDYFFNLPKN
HQQTGWVLTHIGRCYMEIVKYSEAEKYYTEALRIEPYRLEGIEYYSSCLWHLKKQVELCY
LAHQALDKSLFAPETWIAVGNCFSLQKEHENALKFFQRAIQLNQQSAYAHALCGHEFVYN
EDFARARKSFQQALNLDLRNYNAWWGLGNIFYKQEKYNRAAEHFQNAIKINQKNPVLYSF
MGMTLAADRNYSSALQYFEQSEKLDPKNGLNKFQKANTLVKLEKYEAALKELQELNLMMP
KEAPIPMLMGKVYKKLNKTDLALKYFTDALDLENKDTQRIKALIESLHQENQDFGEDLEI


>TTHERM_00691880(gene)
ATGGAGGAAGACGGTTAAAATACAAACTAGACTTTAATTCGCTAACTTATCGATTCTATT
GAAGATAATTTAGCCAATCATCTGCCTTCAAATGCTGTGTTTTTAGCTGAGAGGTTACTC
GCTGAATAAGATACAGAAGAAACACGCGGTATTTTAGCAGAGTGTTACATGGCTGAAAAC
AAGCATTATAAAGTTTATGATATCCTCAAGCTTTGCAAATCAGAAATGAATAGATACAGA
TTTGCTTTAGTTTGTCTTAAGCTTAACAAAAATCAAGGTGAAATCACAATTTAAAACATT
TTTATTTTTTTAGGTGATAGTTTGTGCATGTAAATAAAAAACATAGGCAATCCAAATAAA
TGCAAAACGAAACAAAAAAATTTTATTTAATGAGTACTTTAACTCCTATTTTAATTTAAT
AGACGGAGAAAAAGCTTTGTTAATGGAAAATTACAACCCTTAGGATTAAAATATGTAATC
TAAGCACAGGTCTTAAATGCTACCAGACTACGTTCCTAACGGTTGCTATGGATTCTACTT
ACTTGGTTTAATCTATGAAGGATAATAGAAGTTTTAGGAAGCAAAAAATTATTTTGTGAA
GGCGTTAGAATTAAATCCAACATTATGGGTAGCATATGAAAAGATTTGTAAGATTGGTGA
TTAAGAAATCCTACCTTACAAGGTGATTTTTTATTTATAAAAAGCTTCTCGATTAATAAT
ACTTAAAAAAAACTATTTAAATAAATAAATAAATAGATTTTCTGTGAGACAAAATATAAA
TAATATATCAATTCAAAGAAGGCTAAAGGCTTGTATAGCTTCAATCCATAAGTTAACTTT
TTAAGAAACTTCAAAGAATCTGCTGGTTTTTATAATTCAACTGATGAGTAAAAATTACAA
CTATTGCAAGCAATAAATTAAATTATATAAATTAATATGTTTAAATAATTTACTTATTTG
GTATTTTAATAAATAGGACTGAAGATGGAAATAGTTTAGCAAATCAAGTGGCAAATAAAT
AAAGAATACCTAATCAAGCTAGTAATTAATAAGTTAAACTACATTATATTTATTTTAAAA
TGCTCTTTTATAAACAAATAAGAAGATCAGGGTCTTTAAAGAAATCCAGCTCAGTAAGCA
ATCAAACCTGGAACATCAAATATTTCTACGTAAGTTTATATAAAATCTAGCTATTATTTT
AAGTAAATTATTAATAAATAGTATAGGATAAGTGACTGCAGGAAGAAACGATAGTAATTC
AAGAAATAATAGTGCAAAAAGGAAAAAATCAGGAAAGTTAGATAATGGTGTAGGCCTTTT
AAGCTCTATACCATCACAACCATCTAGTGGTAGCAGTAACATTTAAGGAGGGTAAAATAG
TTAATTAGGCGTAGGTTCTTAACAATTTCCTGCTGCCTCTTCTGCTAACTAATACATTCC
TGGTTAGATGGGTAATTCAAGTGTTTTGCAATTTGATTCCACATCAGCTACTTTATTAGG
TTTATAATAAAAGATGTCTTCTTCTGTTAATAATACAAGTACATCACAGCAATAGCAACA
ACAAATATTATCTTAAGGACTTAATTTGGGCATGAATAATCCTAATCAATTTATATCTGC
AAATAGCTAATTCTAAAATCTTTAAAATACTGTTAATTCGCCTTATATTGAATCTCGCTA
TGGTGGTAGTTAAGATTATTATTAATTTTAAAAACCTACTGCTGCTATGTAGTCTACTGC
TTATAATATTTATGCATAATAAGGAGGTGTTAATAAAAATTTACAAACTCCATAGATAAA
TATGTTACTAAGCAATTAAATGAATTAGCACTAGCTTTAAAGTAACATTTAGCCTTTCTT
TGGAGCTCCTGGATTTTAGTAATAATTGAGTGCAAATGATTTTTCTTAATCTGTTTCCTC
TTCAGCAACTCCTATTAGAGATATTTGCACTCTTCTTAGAAGATTTGGTGAAGCCTTCTA
TCATATGTCACTTTACTTGTGCAAAGAAGCTATTGATTATTTCTTTAACCTTCCTAAAAA
TCATTAACAAACAGGTTGGGTTCTTACTCATATTGGTAGATGCTATATGGAAATTGTTAA
GTACAGTGAAGCTGAAAAGTATTATACTGAAGCTCTAAGAATTGAGCCTTACAGACTAGA
AGGAATTGAGTATTATTCTAGTTGCTTATGGCACTTGAAGAAGCAAGTAGAACTCTGTTA
TCTTGCCCATTAGGCTTTAGATAAGTCTTTATTTGCTCCAGAAACATGGATTGCAGTTGG
AAACTGCTTTAGTTTATAAAAGGAGCATGAAAATGCATTAAAATTCTTCTAAAGAGCAAT
TTAATTGAATCAACAATCAGCCTATGCTCATGCTCTTTGTGGTCATGAATTTGTGTACAA
CGAAGACTTTGCTCGTGCTAGAAAATCATTCCAACAAGCTCTTAATCTTGATCTAAGAAA
TTACAATGCTTGGTGGGGACTTGGTAATATCTTTTATAAATAAGAAAAATACAATCGTGC
AGCTGAACATTTCCAAAATGCAATCAAAATTAATTAAAAAAATCCAGTGCTCTATTCATT
TATGGGTATGACATTAGCTGCAGACAGAAACTATAGCTCAGCCCTTTAATATTTTGAATA
ATCAGAAAAGCTAGACCCTAAAAATGGATTAAATAAATTCTAAAAAGCCAACACTTTAGT
AAAATTAGAGAAATACGAAGCTGCCTTAAAAGAATTATAAGAATTAAATTTGATGATGCC
AAAAGAAGCCCCTATACCTATGCTAATGGGAAAGGTTTATAAAAAGCTTAATAAAACAGA
TCTGGCTTTGAAATACTTTACAGATGCTCTAGATTTAGAAAATAAAGATACCCAAAGAAT
AAAAGCTTTAATAGAATCTCTGCATCAAGAAAATTAAGATTTTGGAGAAGACCTAGAAAT
TTGA