Identifiers and Description

Gene Model Identifier

TTHERM_00691580

Standard Name

None

Aliases

PreTt02996 | 106.m00136 | 3674.m00049

Description

inosine-uridine preferring nucleoside hydrolase; Inosine-uridine preferring nucleoside hydrolase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01156 ) Inosine-uridine preferring nucleoside hydrolase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00691580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17586.19.997093137033517e-262inosine-uridine preferring nuc
leoside hydrolase (324 aa)
DictyBaseDDB_G02727386.998611614275136e-73iunH on chromosome: 2 position
2227186 to 2228208
SGDYDR400W2.000704504372864e-47URH1 Uridine nucleosidase (uri
dine-cytidine N-ribohydrolase)
, cleaves N-glycosidic bonds i
n nucleosides; involved in the
pyrimidine salvage and nicoti
namide riboside salvage pathwa
ys
OxytrichaContig17614.0.g888.996157222146379e-27Inosine-uridine preferring nuc
leoside hydrolase
WormBaseWBGene000174363.0002687256732656e-20status:Confirmed UniProt:Q19
431 protein_id:CCD66045.1
Stentor CoeruleusSteCoe_16660.000000000013887943864964021

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691580(coding)
ATGTCAAATTAAACAGAAAAAAAATTACTTTGGCTTGATTGTGATCCAGGTCATGATGAT
GCTATGGCTATTTATATGGCTGCTTACTCTGAAAAAGTTGAGCTTATTGGAATTTCTACT
GTTTATGGAAATAACACATTAGAAAAGGTTACTAACAATGCATTAAAAATATTAAGAATG
GGAGGTATATATGGAATTCCAGTTTATAAGGGTATGGCTAAACCATTGACTAGAAAGGTG
ACTACTGCTGAAAGCATCCATGGAGATAGTGGGCTTGATGGTTGTGTCCTTCCTGATACT
GATTAAAAAGCAATTACAGAAGATGTACTTCATTAAATTTATCTCAAGATAAAAAGTTTA
CCAAAGAAAATACACTTCGTAGCAACTGGTTGTTTAACAAATCTTGCTTTACTTTTATCA
ACTTTCCCTGATTTTAAGGATTACATTGAATAAATTTCTTTAATGGGAGGAGCTATTGGA
ATTGGAAACTGGTTCCCATGTTCTGAATTTAATATAGGTATTGACCCCGAAGCTTCAAAA
ATCATATTCACTTCTGGATTGCCATTAACTATGGTGCCTATAGAGTTAACACATTAAGTC
TCAATTACAGAAGATATTTTTGATAAATTAAAGGCAATGAAAACTCATTTTGGCGAAAAT
ATAGTAGGATTAATGACCTTCTTTAAACACACTTATAAGACTGTATTTGGATTAGATTTA
GTTCCTCTTCATGATCCATGCGCTGTTTATTATGTCATAAATCCAGATGCATTTACAGTA
AAATTCCTTAATGTAGTTATTGAAACAAATAGTGAATATTGTGATGGTAGAACTGTAGTT
GATGAATATAAAACAACCGGTAGAAAACCTAATACAAACGTTGCTGTTGGGTTAGATTTA
AATGCTTTTTGGGAAGAAATGCTTTCTGCTTTACACAAATGCAACAAAAACACTCCAATC
AATAATTAATGA


>TTHERM_00691580(protein)
MSNQTEKKLLWLDCDPGHDDAMAIYMAAYSEKVELIGISTVYGNNTLEKVTNNALKILRM
GGIYGIPVYKGMAKPLTRKVTTAESIHGDSGLDGCVLPDTDQKAITEDVLHQIYLKIKSL
PKKIHFVATGCLTNLALLLSTFPDFKDYIEQISLMGGAIGIGNWFPCSEFNIGIDPEASK
IIFTSGLPLTMVPIELTHQVSITEDIFDKLKAMKTHFGENIVGLMTFFKHTYKTVFGLDL
VPLHDPCAVYYVINPDAFTVKFLNVVIETNSEYCDGRTVVDEYKTTGRKPNTNVAVGLDL
NAFWEEMLSALHKCNKNTPINNQ


>TTHERM_00691580(gene)
ATGTCAAATTAAACAGAAAAAAAATTACTTTGGCTTGATTGTGATCCAGGTCATGATGAT
GCTATGGCTATTTATATGGCTGCTTACTCTGAAAAAGTTGAGCTTATTGGTAAATAATTT
TGTTCAAGATAAAAAATTTTAATTACAAAATTATAAAGGAATTTCTACTGTTTATGGAAA
TAACACATTAGAAAAGGTTACTAACAATGCATTAAAAATATTAAGAATGGGAGGTATATA
TGGAATTCCAGTTTATAAGGGTATGGCTAAACCATTGACTAGAAAGGTGACTACTGCTGA
AAGCATCCATGGAGATAGTGGGCTTGATGGTTGTGTCCTTCCTGATACTGATTAAAAAGC
AATTACAGAAGATGTACTTCATTAAATTTATCTCAAGATAAAAAGTTTACCAAAGAAAAT
ACACTTCGTAGCAACTGGTTGTTTAACAAATCTTGCTTTACTTTTATCAACTTTCCCTGA
TTTTAAGGATTACATTGAATAAATTTCTTTAATGGGAGGAGCTATTGGAATTGGAAACTG
GTTCCCATGTTCTGAATTTAATATAGGTAAATAATATAGTCTGTATATTACGCAAATTGT
ATTAATAAAATCTAAAAATATTACTAGGTATTGACCCCGAAGCTTCAAAAATCATATTCA
CTTCTGGATTGCCATTAACTATGGTGCCTATAGAGTTAACACATTAAGTCTCAATTACAG
AAGATATTTTTGATAAATTAAAGGCAATGAAAACTCATTTTGGCGAAAATATAGTAGGAT
TAATGACCTTCTTTAAACACACTTATAAGACTGTATTTGGATTAGATTTAGTTCCTCTTC
ATGATCCATGCGCTGTTTATTATGTCATAAATCCAGATGCATTTACAGTAAAATTCCTTA
ATGTAGTTATTGAAACAAATAGTGAATATTGTGATGGTAGAACTGTAGTTGATGAATATA
AAACAACCGGTAGAAAACCTAATACAAACGTTGCTGTTGGGTTAGATTTAAATGCTTTTT
GGGAAGAAATGCTTTCTGCTTTACACAAATGCAACAAAAACACTCCAATCAATAATTAAT
GA