Identifiers and Description

Gene Model Identifier

TTHERM_00689830

Standard Name

None

Aliases

PreTt23179 | 105.m00146 | 3737.m00058

Description

tRNA modification GTPase MnmE; small GTP-binding protein domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR03156 ) GTP-binding protein HflX
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00450 ) tRNA modification GTPase TrmE
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00689830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16631.13.0009023271667765e-140small GTP-binding protein doma
in-containing protein (290 aa)
OxytrichaContig18025.0.g116.000414531663983e-92GTP-binding protein TrmE N-ter
minus
DictyBaseDDB_G02702283.000074895537278e-78gtpbp3 on chromosome: 1 positi
on 4442110 to 4443725
SGDYMR023C4.001670058321624e-73MSS1 Mitochondrial protein, fo
rms a heterodimer complex with
Mto1p that performs the 5-car
boxymethylaminomethyl modifica
tion of the wobble uridine bas
e in mitochondrial tRNAs; simi
lar to human GTPBP3
WormBaseWBGene000095578.998068369452149e-53status:Confirmed UniProt:Q9X
TZ1 protein_id:CAB07393.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00689830(coding)
ATGAATCTACTTAAATATAATAAACTTCAATTTATTTCTAGATATTAATTTTGCTCTACA
AATATTCATTTTTCTGATAATATTTACGCTATAGCTTCAGGAAATGTTAAAGCAGGTGTT
TCAATTATTAGGATAAGCGGGTCTAATTGCTTACAAGCAGGATAGATGCTTGTTTAAAAT
GCATAGCAAAGATAGCTTATAAAAGGGATGAACAATTCTTAAGTATAGGACTATCTTAAT
CTCAAAAATAGATATGCTCATTTTAAAAAATTATATTCTTTGATAGACCCTACAGTTTCT
CCTCAAAACCAATCTTTTCAAAAACAGGATTTAATTTACTAATAAATCGATTAAGGAATT
TTCATGTACTTTTAAGGGCCAAAGAGCTACACTGGAGAAGATATTGTTGAAATGCATATT
CATGGCAGTAGAGCATTATAAAAGAAAGTACTTTTAGAACTTTCTTAGCTTAATAATTTC
AGATTGGCAGATCCAGGAGAGTTCACAAAGAGAGCAATGATAAATAATAAATTAGACTTG
CTTGAAGTAGAGGGGCTTGCTGACCTTCTAAATTCAGAAACAGAGAGTTAAAGAGTTTAG
TCAACTCAATAGTTTCTAGGAAAGTCTAGTTAAATTTTAGAAGATTGGAGGTTTTAGCTT
ATTCGTGCATTAGCCCATGCAGAAGCATTTATTGATTTCGAGTCAGATTAGGATGATGTC
GAATTTAACATCTTAGGTAAAACTTAAGAAAATGTATAATAAGTTATTAAGGATATAAAT
GAGTAGCTTAGTGATAGAAATAGAGGAGAAATATTAAGAGATGGAATGAAGATTTCAATT
ATAGGTAAGCCTAATGCTGGAAAGAGCACTCTGCTCAATTGTCTAGCAAAAAAAGATATA
GCTATTGTAAGTGAAATTCCTGGCACTACTCGTGATGCACTGTCAGTTTCTTTGAATATT
TCTGGTTTTCCAATACTTCTTTATGACACTGCAGGAATTAGGTAGACTAAAGATGTAATT
GAAGAAAAAGGTGTCAATAAAGCTCTATAACATGCTAGAGAGTCAGATTTAAATATTTGG
ATAATTGATATAGATGATGTAATAAAACAAGCGGATGGGTCGTATATTGTTTAAGACATC
AAAGAGATATCAGAAATATTAGAATCAAATTAGAATACTCTTATATTTATAAATAAAATT
GATAAAGTCAACTCATAAAAAGAAATAACTGACATTACAATAAGAGATAAAAAATTTAAA
ATAGATGGATAAATATCAGCACAACATAATTAAAACATAAACTCCCTATTAGATAAATTA
ACTAAAAAAATTAATGAGAGATTAGATATCACTGATGGAATAATGAGCAGTGGGACTATA
TCAATTATAACTTAAACAAGACACAGATTAGAATTACAAAAATGTTTAGAACACCTGGAA
ATTTTCTCAAGAAATAAGCAAAACTTACCAGTTGATATTGTGTGTGAAGAATTAAGATAA
GCAGTTAATTGTATAGGAAGAATAACTGGTAGAGTGGATGTTGAAGAAGTTTTAGATGTA
CTCTTTTCAGAATTTTGTATTGGAAAGTGA


>TTHERM_00689830(protein)
MNLLKYNKLQFISRYQFCSTNIHFSDNIYAIASGNVKAGVSIIRISGSNCLQAGQMLVQN
AQQRQLIKGMNNSQVQDYLNLKNRYAHFKKLYSLIDPTVSPQNQSFQKQDLIYQQIDQGI
FMYFQGPKSYTGEDIVEMHIHGSRALQKKVLLELSQLNNFRLADPGEFTKRAMINNKLDL
LEVEGLADLLNSETESQRVQSTQQFLGKSSQILEDWRFQLIRALAHAEAFIDFESDQDDV
EFNILGKTQENVQQVIKDINEQLSDRNRGEILRDGMKISIIGKPNAGKSTLLNCLAKKDI
AIVSEIPGTTRDALSVSLNISGFPILLYDTAGIRQTKDVIEEKGVNKALQHARESDLNIW
IIDIDDVIKQADGSYIVQDIKEISEILESNQNTLIFINKIDKVNSQKEITDITIRDKKFK
IDGQISAQHNQNINSLLDKLTKKINERLDITDGIMSSGTISIITQTRHRLELQKCLEHLE
IFSRNKQNLPVDIVCEELRQAVNCIGRITGRVDVEEVLDVLFSEFCIGK


>TTHERM_00689830(gene)
ATGAATCTACTTAAATATAATAAACTTCAATTTATTTCTAGATATTAATTTTGCTCTACA
AATATTCATTTTTCTGATAATATTTACGCTATAGCTTCAGGAAATGTTAAAGCAGGTGTT
TCAGTAATCATATTTAGTTTTATTTTTCGCAAATTATAATTTAGATTATTTGTAGATTAT
TAGGATAAGCGGGTCTAATTGCTTACAAGCAGGATAGATGCTTGTTTAAAATGCATAGCA
AAGATAGCTTATAAAAGGGATGAACAATTCTTAAGTATAGGACTATCTTAATCTCAAAAA
TAGATATGCTCATTTTAAAAAATTATATTCTTTGATAGACCCTACAGTTTCTCCTCAAAA
CCAATCTTTTCAAAAACAGGATTTAATTTACTAATAAATCGATTAAGGAATTTTCATGTA
CTTTTAAGGGCCAAAGAGCTACACTGGAGAAGGTAGCTAACTTTTCATATTATATTAAAA
ATTAAGAAAAATTAATTTAAAAAAGATATTGTTGAAATGCATATTCATGGCAGTAGAGCA
TTATAAAAGAAAGTACTTTTAGAACTTTCTTAGCTTAATAATTTCAGATTGGCAGATCCA
GTAAATCAAAATTATAATATTAATTGATATCAATTTTTATTTTTTTTTAAAGGGAGAGTT
CACAAAGAGAGCAATGATAAATAATAAATTAGACTTGCTTGAAGTAGAGGGGCTTGCTGA
CCTTCTAAATTCAGAAACAGAGAGTTAAAGAGTTTAGTCAACTCAATAGTTTCTAGGAAA
GTCTAGTTAAATTTTAGAAGATTGGAGGTTTTAGCTTATTCGTGCATTAGCCCATGCAGA
AGCATTTATTGATTTCGAGTCAGATTAGGTAAAATGAAAATAATTTTGAATAGATTATTG
AATTAATTAAAAAAAATAAATTCAGGATGATGTCGAATTTAACATCTTAGGTAAAACTTA
AGAAAATGTATAATAAGTTATTAAGGATATAAATGAGTAGCTTAGTGATAGAAATAGAGG
AGAAATATTAAGAGATGGAATGAAGATTTCAATTATAGTAATTATTCATTTTTGAAGGTT
TTTATTTTTTATAATATTTTAAAATTAATTATTTTTAAGGGTAAGCCTAATGCTGGAAAG
AGCACTCTGCTCAATTGTCTAGCAAAAAAAGATATAGCTATTGTAAGTGAAATTCCTGGC
ACTACTCGTGATGCACTGTCAGTTTCTTTGAATATTTCTGGTTTTCCAATACTTCTTTAT
GACACTGCAGGAATTAGGTAGACTAAAGATGTAATTGAAGAAAAAGGTGTCAATAAAGCT
CTGTAAAATATTCAAGTATTAAAATAAATAATAAAATTAAAACTTTAATTTGGTAAAATA
AAAAGATAACATGCTAGAGAGTCAGATTTAAATATTTGGATAATTGATATAGATGATGTA
ATAAAACAAGCGGATGGGTCGTATATTGTTTAAGACATCAAAGAGATATCAGAAATATTA
GAATCAAATTAGAATACTCTTATATTTATAAATAAAATTGATAAAGTCAACTCATAAAAA
GAAATAACTGACATTACAATAAGAGATAAAAAATTTAAAATAGATGGATAAATATCAGCA
CAACATAATTAAAACATAAACTCCCTATTAGATAAATTAACTAAAAAAATTAATGAGAGA
TTAGATATCACTGATGGAATAATGAGCAGTGGGACTATATCAATTATAACTTAAACAAGA
CACAGATTAGAATTACAAAAATGTTTAGAACACCTGGAAATTTTCTCAAGAAATAAGCAA
AACTTACCAGTTGATATTGTGTGTGAAGAATTAAGATAAGCAGTTAATTGTATAGGAAGA
ATAACTGGTAGAGTGGATGTTGAAGAAGTTTTAGATGTACTCTTTTCAGAATTTTGTATT
GGAAAGTGA