Identifiers and Description

Gene Model Identifier

TTHERM_00688600

Standard Name

None

Aliases

PreTt23155 | 105.m00122 | 3737.m00035

Description

Sm protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00688600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16652.19.997093137033517e-262Sm protein (2306 aa)
SGDYMR080C0.0000000400154582995175NAM7 ATP-dependent RNA helicas
e of the SFI superfamily invol
ved in nonsense mediated mRNA
decay; required for efficient
translation termination at non
sense codons and targeting of
NMD substrates to P-bodies; in
volved in telomere maintenance

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00688600(coding)
ATGATAACTAAAAGCGAGTTAGAAAAAAAATACTGCTAAATGTAGCCTTAATTGTAAAAC
CTTATCTAATAAAATGAAATTAAAAATAAGCTATCAGATAGATAAAAAGCTATTATTATA
ACACCTAAATCTCTAAAACAATAGTTCGATGAATCTCTACTTGCGAATAGCAACAAAAGC
TAAAATGATAGTATTAGATCTGGAGTTTATAAAGCTACAGAGCTAGACAGTAAATTATAA
AGCATTTTAAACTCAAATGGAAAATCTGTTGAAGCTATGATAGTAGATAGATCATATAAT
CCTGCAAGACTTAAAAGCTAAAACACATCTTTTCATGTGAGCGGAAATTAAACACCAATA
GTAGAATATAACCAAAATTATGAAAGAGCCATGAAAATGTAAAAGTAACTAGAAATATAG
GCTCTTTCTTCAGCACCATCAAATTAATTAAACAATGAAAATATTTATAATCATAGTGGG
GCTACTAGTTTTTATAGTATTTCTAGCTATTCATCTAATCCTCAAGCTAGCGTAAGAGTC
CCTTCTTCAGAATATGCAATTAATGAAGAATTTTCATAATAAAAACCACTGTTTAAATAG
CCTCTACCTATTACCAAGGAAGAAAATTAACAGAAATCTAAGTAATTTAATCTATTATAA
AGCAATTAAAAAATTCAAACAATTAACTAACTCGCCAATTTGAAAGAAATAGTGAGATAA
AAGAAAATTAATGAGCACATTAGGCAATACTAAATTCCTCTAAAAAAGATTAAACAAGAA
GAAAATTTAATTAATTAAAATAATACAAATTTGAATTTATAAAATTTAGATAACACATCT
AGTTTAACAGTTAAAAACAGCTAAGGTTTAAATACTGCAGAAAAAAGTATTCTTTATAAA
CCTGAATATTATTAAAAAGTTGGTTTACCTATGCCTGACTCAGTTGCTAAGTAAAAAAAG
TTAGAAAGAGAGATAGAATATGTAAAAGAAAATGTAAAGCCACAGACTAATGACAGTAAA
TCTCTTTGGCTAAATTAAAACTTTAGAAAAAGCGATTAAGAAAACAGAAATATAAGTTAA
AAGTAAATTAATAATGATCAAAATAAATAGAAAGAATAACAAAACAATTAAATCGAATTT
AATAATTAAAATAAAAATATTAATTTGAAATAAGGAAAACAAATATTAGGTTTTAGGGCT
GAAGATATAAATTAAAAACCATCTTTTTAAAATTGTTTGCAAAAGAGTATACAAAATTAA
AGTACTCAATAATATAATAGCTCTAAAGATTAATCAAATAGCAATTTTAACTCTTAAGAC
CCTAGACTGACCTTATAATAAAAAGTATATCCTTAATAAAATAAAGATGATAGTTTATTT
TAAGAAAATTAAAATAATAACAAAAATTCTTAGTAATTTAATTTCAACAATAATCATACT
TTAAGTTAAATTTAGCTTTAGTCATCTTTAATTAGTTAAAATTCAAAATAAGAAAATTAA
GGTGAATAAAATGCCATTAAACAACTTTTAAGTATATAATAAAATTAAAATTAATAATTA
ATAGATTAAAAAGACTAAATTATGAACTAAGTTAAAGATGTAATTCTTATGCTTATAGAA
AAAGAAAAAAATAAAAAAACAGAAGAATAGTTAAAAGCAAAATAATAAAATTAAGAATAA
AAACCAGAAGCAACTATGAATAATCTAAATAAAATCAAACAATAACATGTAAACGATCCT
ATTCAATAGCAAAGAACATTTCAATAATTATAGAATTTCAACAAGCAAAGCAAAAATGAT
ACTAAATTTTAAGAAAAGTAGGTTTATAGAAATGATTAACTTTAATAAAAAATAGATGAA
AGCCAAAGAATAAACCTAAATTAAAGTGGATAGAGTATGTTAAATGAAAACATAAAGATT
TAATAAAATTTCTAAATTCAGCATTAAATTACTTCTAATTTATAAAATAATAATATTTAA
ATTTCAAATATGCCAAGCAATAATCAATAAACCACATAAAATAATTTTGTTAAAATTAAT
TAGTAATAACCACAAGCTTATTAAACTTAGCATTTAATTTAAATGAATTATAATAATTAG
TTTAACAATACCTCAGTTAATAACTCTTAACTTAACAAAGAGCAAAACATATACTAATAA
TTTAAAAAACAAGAAGATTGCCAAAAATAAAATAATTAAAATTTTTTATAAAATTAAGAA
AATATTTTAGATTTACTAAATCCAAAGCATCTACTTAATTTTAATTCTTAAATTGCTGAT
AATCAAGCAAATTAATAAGTTAGTTAAAAACCAGAAATTGTAATTTAAAATAAAGAAGGA
ATATTCTCATAAAATGGACAAAATAATATTCATTTAACTTAAGCTTAGTAATAAAAATAA
TAGCTTAATAATATTTAATAATTATAAATTCCTTAGTCAACCTCTCAAGCAAGCTTAAAA
ATCCCTGATTAAATAACCTGCTCCATACCATAGGGTACATTGGCTGAAATTAAAAAAGCT
CAAATTGAATTTTAATAGATATAAACTTAAAACTTGTAAAAGAGACTTCTTAGCTAGCAT
GAAAAAAAGGTTTTATTTATTGTTTGGATGAAGAAAAATCTTTAAGATTTTAATTATTGG
ATTTAAAAATCAAAAAGCATTTTAGATTTTAACTTTATTGAAGAAAAAGGATAATTCAAG
TGTGAAGCAAAGCTAAACATCCCTATGGATGGCATTAAGTGCTTATGTGCTTTTGGATTG
GGATCTAACAAAAAAGAGTCAAAAAAGAATGCTATGGAATAACTAGCTATTTATGTAATA
TTAAATGATTAAATTTTTTGGGTGGGAATAACTGGAAGATAGTATCTAGAAAGTGTTCTT
TAAGAGTATAATTCAATAGTTAATACATAGGAGGGTTAAACTATTCTTAAATAAATAAAA
CAATTTACAAACTTTATTGATGATGATGAACCAAAAACATATATTGATTAAAATATGGAA
ATTGAATAACTAAATTAGCAAAATCTTCAATCTTAAAAAAATTCAAATTTAAATGATACT
GATAACTTAAATTAAAATAATAATATAAATGGAAATAATTAAGCAAAAGCAAAAAATTAG
CTTAAATAGCTAAAAAAATAAAAAATATCATAAAATAAATCACCTAAAAGTGATATTAAG
GAAGTTGATAAATTGAATGATGACTTAAGTGGATGCAAGAGTAAGCTAAAAGTTTAAAAG
TATTTGAAGAGAATTTAAAGTTGCTTACAGGAAGATAAAATTATAGAAGCTTTAGAAAAA
TTAGCGTTAGTTGGAAGCTTAAAGAATGAATTAAAATATAGAGATTTTTGTTATATTTGG
AATTATGCTATACAATCTAGGAATTTAACTGTTCTTAAAATATGCCTTGATGTTATACAT
TACCGTAAGATGTCAAGCCAAATGACAGAGACAATTTAATTCTAATCGTCTGCAGATACA
GCAAAATAATTGTTTAATCCTATTTTGTAAAGTGAATAATTAACTTAAATTAATTTTACT
CTTCAAAAGTTTGTTTCAACCCAAAGAATTCCTGTTATTAATAATTAATTTGAATAATTT
AATACTAATATTTCTTATTTAGTAGATGATGAGTGGTTTACTATGAGAGAAAATCCTAAT
GCTCATTTCTTCTCATAATTTAATTTTAATAAATAGTTTTAAAATTAAAGCTTTGCTAGT
TAAAGTGATACTTAGTCGATATATCAGGCAATCGACTTTGATAATTTCTCTGTTGAAAAC
AACCTAGAAACAGTCTAACATCTAAGATTTGCTAGAAATCGTTTTTAGAAGAGTGGCAAT
AAGAGTTAAGAGAATTCAAGCTCATCTAATAAGTAAAAATTATATATATCAGCTGGTAAG
AAAAAAACTATTTTATCTGGTGTAGGCGGAAGTGGATAAAAAGAAGATATAGACCTAAGG
AATGCATCATTTGTCAGGTCCTCTGCTTTATTCTTCAAAAACTTAATCAATTAGTAGAGA
GTTAGTAATTTTAATATTGCCTAATAAAGCCAAATTATAAGAAAAGATCCTTACTTGCAG
TATCTTAGCTGGGAAGACTTGAATCAAATGTACTCCAGCCTTTTATATATAGACGATCCT
ATATTTGCTTTATAAGCCTGCGAGTTAATTTATACATAAACAAAAATAGATCAAGATCTT
CTTATCAATGGATCTTTGAACTATTTTGTAAACAGAAAAGTAATTCTTTATGAAGACTTT
TTTGAAAGTTTACTGGCTAAAATTAATAAAAGTAATTAATTGCAAAAAAATAATAGCTAA
GAATCCTAAAATTCATAGCAAATTTAATAGTAACAATAGCAAAGTAATGTAATAAGAAAG
GGTGAAAAGTTTGTATGTTAAGGATTCATATAGTACCTGGGAAGTAATTATGAGTATGAT
CAATTCAGTTTTAGAGTTTTAGGTGAAAATGGAGAAATTTTACCATAAGGATGCTATTAA
ATACAAGAAGGAGATCTATGTGTGTTATAACCAAAAAATTTACCTGCATTATAAAGCTAC
TCAACTATGATAAATTAAAATAATAGATATATTTGCTTAGTTAAAGAATTAGGTGAAGAA
AATGGATTGCAAAATAATATTAATTAGGGGTAGAACTAAACTAAAATTAATAATCTTGCT
AACACTACTTATCAGACATTTAAATTAAGCATTGTCTTGACAAACTGCAAGTAAAGAAGC
AAGCTGATAGCCGATTACTCTCAAGTTTATTCTCTGTATAAAATAGCTTCAACAAATTCA
TTAAGAGAAAAAAGTAAATCACTTGATAATATGTGTACAAAAGTATCAATGCTTCATTCA
ATTTTTAATTCTATCGTTTTATGCAATAATTTCAGTACTAATTAGTAGCAGATTTAAGTT
ATCGAGCAAAATAAAACTAGTCCTCAGCAGAGTTAGAGAGAGGAGCAAATGAGGTAATCA
ACTATAGTTGCAACTGAAGTAAATTTGTAAGAAATAGCTATGGAAAATAATTTAAATTAG
GATTAGGTAGATGCCTTGTACAGTGGGAGTGTTAACTCTCTTACTCTTATTCAGGGAGTA
AAACATACTGGTAGATTTAGGGTAGCTATCAGTATAATTCAAGAATGGTTAATATAATCA
AATTTAAAAATTCTTGTAAAATGCGATACTGATTATAAAGCTAGGTTATTTTACAATAGC
TTAGTTAGTATGTAATAAAGTGTATCGGTTAACTCGTAATCTAACTTTTCATCTGAAAGT
TCATCAAAATTACTAAAAAATAGTGCTTTTTAAGCAAATATTTGCTTTGTTTTAGAAGAT
AGTTCAATAGAATTTTTTAACTCAACATCTAGACAATTTATGACTTCTAAAATGAGTGCA
AAAGTAAAAAGATCAATTGATGAAAGCAAAATAATTATTCTTGGTTCATCTTCTCTCCAC
TAAAGCAATAGTTAATGCAATATAGTTAATTCTGTACAAATAGCCAACAATAGTAATTGC
CAACTACTATCTGCTTTTAGTGCTCTTAGAGATTGTTCTTTTAATAGGGTAATATTTTAC
AATTCTGAATAAATACAAGAATCAAATACTTGGGAATATTTGGTAAAAAATTGTAATTAA
TGTGTGATGATTGGTGACTTAACTGCATTCTAAAGAGAACAAACAAGAAACCTTTTCACA
AAAAGTAGGTTTGGTGATAGAAGTATTTTTGAAAATTTAATACTGAGTGGATTCAAACCA
ATTGTACTCAGAAAAAGATATTTATTCAAATAGTCATTAGTAAATAATTAAAAAGTGGTT
ATTAAAAGTTAAAATATTCCTACTAATACTTATAATATTGCTTCTCTTCATAATAACTTA
TTCTTTGATAATTAATTGATTTTATTTAACAATGATAATAATTCACCTTCATAAATTAAC
CCAGAAGCTTTGAATGATTCTGAATCTTCTGAAATATTAATTATCGCACTTAAAGGAAAA
GAAGAAGTTTCTAATCCAACAAGCAACAGAACAATCAGCGATACAGGAAGTATTTATAAC
ACTGATGAGATTTATATGATCTTAGCTATAGTAAATAATCTAGTAAACATAGATAGAATC
AACCTCTCTTAAATTAGAGTTATTACTCCAACTATTGCTCAAAAAACTCAATTGCAAATT
ATCTCCTCCTAAAAATTAAAATTTGTTGTCAATGCTCAGACAATCTAAGAGCCTATCAAT
TAAACATATGAATATGTGTTATTCTCTGCAGTCAAAAGTAATGAGAGAGAGGATATTGGT
GTAGCTAGAAATCCTTCTATACTTAGTAGTATGCTTTAACACACAACTCAAAAGTTTATA
TTTATAGGTGATATAGATCTTTATTCTATAGATCCAACTTGGTCAGATCTTTTTTAAAAG
GCATTTGCAAAAAAATAAATCAAATTTTATCATTAATACCAAAAATTATCTAAAAATTTA
TGTAAAATCTTTGACTCTGAAGAGAAAGAGTTAGGAGAACTATGA


>TTHERM_00688600(protein)
MITKSELEKKYCQMQPQLQNLIQQNEIKNKLSDRQKAIIITPKSLKQQFDESLLANSNKS
QNDSIRSGVYKATELDSKLQSILNSNGKSVEAMIVDRSYNPARLKSQNTSFHVSGNQTPI
VEYNQNYERAMKMQKQLEIQALSSAPSNQLNNENIYNHSGATSFYSISSYSSNPQASVRV
PSSEYAINEEFSQQKPLFKQPLPITKEENQQKSKQFNLLQSNQKIQTINQLANLKEIVRQ
KKINEHIRQYQIPLKKIKQEENLINQNNTNLNLQNLDNTSSLTVKNSQGLNTAEKSILYK
PEYYQKVGLPMPDSVAKQKKLEREIEYVKENVKPQTNDSKSLWLNQNFRKSDQENRNISQ
KQINNDQNKQKEQQNNQIEFNNQNKNINLKQGKQILGFRAEDINQKPSFQNCLQKSIQNQ
STQQYNSSKDQSNSNFNSQDPRLTLQQKVYPQQNKDDSLFQENQNNNKNSQQFNFNNNHT
LSQIQLQSSLISQNSKQENQGEQNAIKQLLSIQQNQNQQLIDQKDQIMNQVKDVILMLIE
KEKNKKTEEQLKAKQQNQEQKPEATMNNLNKIKQQHVNDPIQQQRTFQQLQNFNKQSKND
TKFQEKQVYRNDQLQQKIDESQRINLNQSGQSMLNENIKIQQNFQIQHQITSNLQNNNIQ
ISNMPSNNQQTTQNNFVKINQQQPQAYQTQHLIQMNYNNQFNNTSVNNSQLNKEQNIYQQ
FKKQEDCQKQNNQNFLQNQENILDLLNPKHLLNFNSQIADNQANQQVSQKPEIVIQNKEG
IFSQNGQNNIHLTQAQQQKQQLNNIQQLQIPQSTSQASLKIPDQITCSIPQGTLAEIKKA
QIEFQQIQTQNLQKRLLSQHEKKVLFIVWMKKNLQDFNYWIQKSKSILDFNFIEEKGQFK
CEAKLNIPMDGIKCLCAFGLGSNKKESKKNAMEQLAIYVILNDQIFWVGITGRQYLESVL
QEYNSIVNTQEGQTILKQIKQFTNFIDDDEPKTYIDQNMEIEQLNQQNLQSQKNSNLNDT
DNLNQNNNINGNNQAKAKNQLKQLKKQKISQNKSPKSDIKEVDKLNDDLSGCKSKLKVQK
YLKRIQSCLQEDKIIEALEKLALVGSLKNELKYRDFCYIWNYAIQSRNLTVLKICLDVIH
YRKMSSQMTETIQFQSSADTAKQLFNPILQSEQLTQINFTLQKFVSTQRIPVINNQFEQF
NTNISYLVDDEWFTMRENPNAHFFSQFNFNKQFQNQSFASQSDTQSIYQAIDFDNFSVEN
NLETVQHLRFARNRFQKSGNKSQENSSSSNKQKLYISAGKKKTILSGVGGSGQKEDIDLR
NASFVRSSALFFKNLINQQRVSNFNIAQQSQIIRKDPYLQYLSWEDLNQMYSSLLYIDDP
IFALQACELIYTQTKIDQDLLINGSLNYFVNRKVILYEDFFESLLAKINKSNQLQKNNSQ
ESQNSQQIQQQQQQSNVIRKGEKFVCQGFIQYLGSNYEYDQFSFRVLGENGEILPQGCYQ
IQEGDLCVLQPKNLPALQSYSTMINQNNRYICLVKELGEENGLQNNINQGQNQTKINNLA
NTTYQTFKLSIVLTNCKQRSKLIADYSQVYSLYKIASTNSLREKSKSLDNMCTKVSMLHS
IFNSIVLCNNFSTNQQQIQVIEQNKTSPQQSQREEQMRQSTIVATEVNLQEIAMENNLNQ
DQVDALYSGSVNSLTLIQGVKHTGRFRVAISIIQEWLIQSNLKILVKCDTDYKARLFYNS
LVSMQQSVSVNSQSNFSSESSSKLLKNSAFQANICFVLEDSSIEFFNSTSRQFMTSKMSA
KVKRSIDESKIIILGSSSLHQSNSQCNIVNSVQIANNSNCQLLSAFSALRDCSFNRVIFY
NSEQIQESNTWEYLVKNCNQCVMIGDLTAFQREQTRNLFTKSRFGDRSIFENLILSGFKP
IVLRKRYLFKQSLVNNQKVVIKSQNIPTNTYNIASLHNNLFFDNQLILFNNDNNSPSQIN
PEALNDSESSEILIIALKGKEEVSNPTSNRTISDTGSIYNTDEIYMILAIVNNLVNIDRI
NLSQIRVITPTIAQKTQLQIISSQKLKFVVNAQTIQEPINQTYEYVLFSAVKSNEREDIG
VARNPSILSSMLQHTTQKFIFIGDIDLYSIDPTWSDLFQKAFAKKQIKFYHQYQKLSKNL
CKIFDSEEKELGEL


>TTHERM_00688600(gene)
ATGATAACTAAAAGCGAGTTAGAAAAAAAATACTGCTAAATGTAGCCTTAATTGTAAAAC
CTTATCTAATAAAATGAAATTAAAAATAAGCTATCAGATAGATAAAAAGCTATTATTATA
ACACCTAAATCTCTAAAACAATAGTTCGATGAATCTCTACTTGCGAATAGCAACAAAAGC
TAAAATGATAGTATTAGATCTGGAGTTTATAAAGCTACAGAGCTAGACAGTAAATTATAA
AGCATTTTAAACTCAAATGGAAAATCTGTTGAAGCTATGATAGTAGATAGATCATATAAT
CCTGCAAGACTTAAAAGCTAAAACACATCTTTTCATGTGAGCGGAAATTAAACACCAATA
GTAGAATATAACCAAAATTATGAAAGAGCCATGAAAATGTAAAAGTAACTAGAAATATAG
GCTCTTTCTTCAGCACCATCAAATTAATTAAACAATGAAAATATTTATAATCATAGTGGG
GCTACTAGTTTTTATAGTATTTCTAGCTATTCATCTAATCCTCAAGCTAGCGTAAGAGTC
CCTTCTTCAGAATATGCAATTAATGAAGAATTTTCATAATAAAAACCACTGTTTAAATAG
CCTCTACCTATTACCAAGGAAGAAAATTAACAGAAATCTAAGTAATTTAATCTATTATAA
AGCAATTAAAAAATTCAAACAATTAACTAACTCGCCAATTTGAAAGAAATAGTGAGATAA
AAGAAAATTAATGAGCACATTAGGCAATACTAAATTCCTCTAAAAAAGATTAAACAAGAA
GAAAATTTAATTAATTAAAATAATACAAATTTGAATTTATAAAATTTAGATAACACATCT
AGTTTAACAGTTAAAAACAGCTAAGGTTTAAATACTGCAGAAAAAAGTATTCTTTATAAA
CCTGAATATTATTAAAAAGTTGGTTTACCTATGCCTGACTCAGTTGCTAAGTAAAAAAAG
TTAGAAAGAGAGATAGAATATGTAAAAGAAAATGTAAAGCCACAGACTAATGACAGTAAA
TCTCTTTGGCTAAATTAAAACTTTAGAAAAAGCGATTAAGAAAACAGAAATATAAGTTAA
AAGTAAATTAATAATGATCAAAATAAATAGAAAGAATAACAAAACAATTAAATCGAATTT
AATAATTAAAATAAAAATATTAATTTGAAATAAGGAAAACAAATATTAGGTTTTAGGGCT
GAAGATATAAATTAAAAACCATCTTTTTAAAATTGTTTGCAAAAGAGTATACAAAATTAA
AGTACTCAATAATATAATAGCTCTAAAGATTAATCAAATAGCAATTTTAACTCTTAAGAC
CCTAGACTGACCTTATAATAAAAAGTATATCCTTAATAAAATAAAGATGATAGTTTATTT
TAAGAAAATTAAAATAATAACAAAAATTCTTAGTAATTTAATTTCAACAATAATCATACT
TTAAGTTAAATTTAGCTTTAGTCATCTTTAATTAGTTAAAATTCAAAATAAGAAAATTAA
GGTGAATAAAATGCCATTAAACAACTTTTAAGTATATAATAAAATTAAAATTAATAATTA
ATAGATTAAAAAGACTAAATTATGAACTAAGTTAAAGATGTAATTCTTATGCTTATAGAA
AAAGAAAAAAATAAAAAAACAGAAGAATAGTTAAAAGCAAAATAATAAAATTAAGAATAA
AAACCAGAAGCAACTATGAATAATCTAAATAAAATCAAACAATAACATGTAAACGATCCT
ATTCAATAGCAAAGAACATTTCAATAATTATAGAATTTCAACAAGCAAAGCAAAAATGAT
ACTAAATTTTAAGAAAAGTAGGTTTATAGAAATGATTAACTTTAATAAAAAATAGATGAA
AGCCAAAGAATAAACCTAAATTAAAGTGGATAGAGTATGTTAAATGAAAACATAAAGATT
TAATAAAATTTCTAAATTCAGCATTAAATTACTTCTAATTTATAAAATAATAATATTTAA
ATTTCAAATATGCCAAGCAATAATCAATAAACCACATAAAATAATTTTGTTAAAATTAAT
TAGTAATAACCACAAGCTTATTAAACTTAGCATTTAATTTAAATGAATTATAATAATTAG
TTTAACAATACCTCAGTTAATAACTCTTAACTTAACAAAGAGCAAAACATATACTAATAA
TTTAAAAAACAAGAAGATTGCCAAAAATAAAATAATTAAAATTTTTTATAAAATTAAGAA
AATATTTTAGATTTACTAAATCCAAAGCATCTACTTAATTTTAATTCTTAAATTGCTGAT
AATCAAGCAAATTAATAAGTTAGTTAAAAACCAGAAATTGTAATTTAAAATAAAGAAGGA
ATATTCTCATAAAATGGACAAAATAATATTCATTTAACTTAAGCTTAGTAATAAAAATAA
TAGCTTAATAATATTTAATAATTATAAATTCCTTAGTCAACCTCTCAAGCAAGCTTAAAA
ATCCCTGATTAAATAACCTGCTCCATACCATAGGGTACATTGGCTGAAATTAAAAAAGCT
CAAATTGAATTTTAATAGATATAAACTTAAAACTTGTAAAAGAGACTTCTTAGCTAGCAT
GAAAAAAAGGTTTTATTTATTGTTTGGATGAAGAAAAATCTTTAAGATTTTAATTATTGG
ATTTAAAAATCAAAAAGCATTTTAGATTTTAACTTTATTGAAGAAAAAGGATAATTCAAG
TGTGAAGCAAAGCTAAACATCCCTATGGATGGCATTAAGTGCTTATGTGCTTTTGGATTG
GGATCTAACAAAAAAGAGTCAAAAAAGAATGCTATGGAATAACTAGCTATTTATGTAATA
TTAAATGATTAAATTTTTTGGGTGGGAATAACTGGAAGATAGTATCTAGAAAGTGTTCTT
TAAGAGTATAATTCAATAGTTAATACATAGGAGGGTTAAACTATTCTTAAATAAATAAAA
CAATTTACAAACTTTATTGATGATGATGAACCAAAAACATATATTGATTAAAATATGGAA
ATTGAATAACTAAATTAGCAAAATCTTCAATCTTAAAAAAATTCAAATTTAAATGATACT
GATAACTTAAATTAAAATAATAATATAAATGGAAATAATTAAGCAAAAGCAAAAAATTAG
CTTAAATAGCTAAAAAAATAAAAAATATCATAAAATAAATCACCTAAAAGTGATATTAAG
GAAGTTGATAAATTGAATGATGACTTAAGTGGATGCAAGAGTAAGCTAAAAGTTTAAAAG
TATTTGAAGAGAATTTAAAGTTGCTTACAGGAAGATAAAATTATAGAAGCTTTAGAAAAA
TTAGCGTTAGTTGGAAGCTTAAAGAATGAATTAAAATATAGAGATTTTTGTTATATTTGG
AATTATGCTATACAATCTAGGAATTTAACTGTTCTTAAAATATGCCTTGATGTTATACAT
TACCGTAAGATGTCAAGCCAAATGACAGAGACAATTTAATTCTAATCGTCTGCAGATACA
GCAAAATAATTGTTTAATCCTATTTTGTAAAGTGAATAATTAACTTAAATTAATTTTACT
CTTCAAAAGTTTGTTTCAACCCAAAGAATTCCTGTTATTAATAATTAATTTGAATAATTT
AATACTAATATTTCTTATTTAGTAGATGATGAGTGGTTTACTATGAGAGAAAATCCTAAT
GCTCATTTCTTCTCATAATTTAATTTTAATAAATAGTTTTAAAATTAAAGCTTTGCTAGT
TAAAGTGATACTTAGTCGATATATCAGGCAATCGACTTTGATAATTTCTCTGTTGAAAAC
AACCTAGAAACAGTCTAACATCTAAGATTTGCTAGAAATCGTTTTTAGAAGAGTGGCAAT
AAGAGTTAAGAGAATTCAAGCTCATCTAATAAGTAAAAATTATATATATCAGCTGGTAAG
AAAAAAACTATTTTATCTGGTGTAGGCGGAAGTGGATAAAAAGAAGATATAGACCTAAGG
AATGCATCATTTGTCAGGTCCTCTGCTTTATTCTTCAAAAACTTAATCAATTAGTAGAGA
GTTAGTAATTTTAATATTGCCTAATAAAGCCAAATTATAAGAAAAGATCCTTACTTGCAG
TATCTTAGCTGGGAAGACTTGAATCAAATGTACTCCAGCCTTTTATATATAGACGATCCT
ATATTTGCTTTATAAGCCTGCGAGTTAATTTATACATAAACAAAAATAGATCAAGATCTT
CTTATCAATGGATCTTTGAACTATTTTGTAAACAGAAAAGTAATTCTTTATGAAGACTTT
TTTGAAAGTTTACTGGCTAAAATTAATAAAAGTAATTAATTGCAAAAAAATAATAGCTAA
GAATCCTAAAATTCATAGCAAATTTAATAGTAACAATAGCAAAGTAATGTAATAAGAAAG
GGTGAAAAGTTTGTATGTTAAGGATTCATATAGTACCTGGGAAGTAATTATGAGTATGAT
CAATTCAGTTTTAGAGTTTTAGGTGAAAATGGAGAAATTTTACCATAAGGATGCTATTAA
ATACAAGAAGGAGATCTATGTGTGTTATAACCAAAAAATTTACCTGCATTATAAAGCTAC
TCAACTATGATAAATTAAAATAATAGATATATTTGCTTAGTTAAAGAATTAGGTGAAGAA
AATGGATTGCAAAATAATATTAATTAGGGGTAGAACTAAACTAAAATTAATAATCTTGCT
AACACTACTTATCAGACATTTAAATTAAGCATTGTCTTGACAAACTGCAAGTAAAGAAGC
AAGCTGATAGCCGATTACTCTCAAGTTTATTCTCTGTATAAAATAGCTTCAACAAATTCA
TTAAGAGAAAAAAGTAAATCACTTGATAATATGTGTACAAAAGTATCAATGCTTCATTCA
ATTTTTAATTCTATCGTTTTATGCAATAATTTCAGTACTAATTAGTAGCAGATTTAAGTT
ATCGAGCAAAATAAAACTAGTCCTCAGCAGAGTTAGAGAGAGGAGCAAATGAGGTAATCA
ACTATAGTTGCAACTGAAGTAAATTTGTAAGAAATAGCTATGGAAAATAATTTAAATTAG
GATTAGGTAGATGCCTTGTACAGTGGGAGTGTTAACTCTCTTACTCTTATTCAGGGAGTA
AAACATACTGGTAGATTTAGGGTAGCTATCAGTATAATTCAAGAATGGTTAATATAATCA
AATTTAAAAATTCTTGTAAAATGCGATACTGATTATAAAGCTAGGTTATTTTACAATAGC
TTAGTTAGTATGTAATAAAGTGTATCGGTTAACTCGTAATCTAACTTTTCATCTGAAAGT
TCATCAAAATTACTAAAAAATAGTGCTTTTTAAGCAAATATTTGCTTTGTTTTAGAAGAT
AGTTCAATAGAATTTTTTAACTCAACATCTAGACAATTTATGACTTCTAAAATGAGTGCA
AAAGTAAAAAGATCAATTGATGAAAGCAAAATAATTATTCTTGGTTCATCTTCTCTCCAC
TAAAGCAATAGTTAATGCAATATAGTTAATTCTGTACAAATAGCCAACAATAGTAATTGC
CAACTACTATCTGCTTTTAGTGCTCTTAGAGATTGTTCTTTTAATAGGGTAATATTTTAC
AATTCTGAATAAATACAAGAATCAAATACTTGGGAATATTTGGTAAAAAATTGTAATTAA
TGTGTGATGATTGGTGACTTAACTGCATTCTAAAGAGAACAAACAAGAAACCTTTTCACA
AAAAGTAGGTTTGGTGATAGAAGTATTTTTGAAAATTTAATACTGAGTGGATTCAAACCA
ATTGTACTCAGAAAAAGATATTTATTCAAATAGTCATTAGTAAATAATTAAAAAGTGGTT
ATTAAAAGTTAAAATATTCCTACTAATACTTATAATATTGCTTCTCTTCATAATAACTTA
TTCTTTGATAATTAATTGATTTTATTTAACAATGATAATAATTCACCTTCATAAATTAAC
CCAGAAGCTTTGAATGATTCTGAATCTTCTGAAATATTAATTATCGCACTTAAAGGAAAA
GAAGAAGTTTCTAATCCAACAAGCAACAGAACAATCAGCGATACAGGAAGTATTTATAAC
ACTGATGAGATTTATATGATCTTAGCTATAGTAAATAATCTAGTAAACATAGATAGAATC
AACCTCTCTTAAATTAGAGTTATTACTCCAACTATTGCTCAAAAAACTCAATTGCAAATT
ATCTCCTCCTAAAAATTAAAAGTAATTCATTTATTTAAATTTTATTAAAAATTAATTTTT
AATTATTTAATTTAGTTTGTTGTCAATGCTCAGACAATCTAAGAGCCTATCAATTAAACA
TATGAATATGTGTTATTCTCTGCAGTCAAAAGTAATGAGAGAGAGGATATTGGTGTAGCT
AGAAATCCTTCTATACTTAGTAGTATGCTTTAACACACAACTCAAAAGTTTATATTTATA
GGTGATATAGATCTTTATTCTATAGATCCAACTTGGTCAGATCTTTTTTAAAAGGCATTT
GCAAAAAAATAAATCAAATTTTATCATTAATACCAAAAATTATCTAAAAATTTATGTAAA
ATCTTTGACTCTGAAGAGAAAGAGTTAGGAGAACTATGA