Identifiers and Description

Gene Model Identifier

TTHERM_00686060

Standard Name

None

Aliases

PreTt18220 | 104.m00152 | 3732.m00065 | UBQ1

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08394 ) Archaeal TRASH domain
  • ( PF00097 ) zinc finger, C3HC4 type (RING

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 296

No
Presense Probability:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 297

0%

TetraMine Data

TTHERM_00686060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17392.16.99920276797163e-121hypothetical protein (187 aa)
OxytrichaContig1781.0.g941.999981404597394e-31Zinc finger, C3HC4 type (RING
finger)
DictyBaseDDB_G02853335.998186291993296e-23DDB_G0285333 on chromosome: 4
position 3097865 to 3099004
WormBaseWBGene000043819.000561397357242e-21locus:rnf-5 RING finger prot
ein 5 status:Confirmed Uni
Prot:Q09463 protein_id:CAA86
745.1
Stentor CoeruleusSteCoe_130500.0000000000006914400106940203
SGDYLR323C0.000000100009565553302CWC24 Essential protein, compo
nent of a complex containing C
ef1p; has similarity to S. pom
be Cwf24p

General Information

Paragraph NoGene NameParagraph Text
123TTHERM_00686060The UBQ1 protein contains one domain. The domain (E-value=2.4E-11) is a zinc finger structure that binds two zinc cations and some DNA, RNA, or protein molecules. The closest homologs are in Paramecium tetraurelia strain d4-2, stylonychia lemnae, and oxytricha trifallax. UBQ1 may play an integral role in the ubiquitination pathway, which attaches ubiquitin to substrate proteins. The effect of ubiquitination may affect the substrate protein in various ways including: marking for degradation, altering location, changing protein activity, or promoting and preventing protein interactions.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00686060(coding)
ATGTAGCATTAATAGCATGATGAAGAAGAATAAAAAAGCAGTGCAAGTGATATTCATGCT
TTGTTAGAGAAATTCGAATGCACAGTTTGTTTAGAAGTTGCAAAAGAACCTGTTGTCACA
GAATGCGGTCATTTATTTTGCTGGCCATGCATTTATAAGTGGTTGAATTAAAATAATGAG
TATTTAGTATGTCCAAATTGCAAAAATGGAATTAAAAAAGAACTAATAAGACCTCTTTAT
GCTCGTAATGAAGATGATACCCACCAAAAATAGAGAGATTCAAATATACCTAAAAGAGCA
TTACCTCCTCGTTAAATCCCTTAAAAAAATTAAAATCACCTTGGAGGAAGAGTCTCTTCA
GCAAATTTATCATTAGGAGTAAGCTTTGCAGGTTATGGATACTTCCCATCTTTGTATGGC
TTGTTAAATCAATATAAAAATAACATTACAGATCAGTTGGAGTCAAATGTTTCTCCGGAA
GTTGCAAAGCAACCGTTTTTAGAAAGATTCTTTTACATTTTGTGCATATTATGTATTTTA
TTTTTAGTTTTTTGTATGTGA


>TTHERM_00686060(protein)
MQHQQHDEEEQKSSASDIHALLEKFECTVCLEVAKEPVVTECGHLFCWPCIYKWLNQNNE
YLVCPNCKNGIKKELIRPLYARNEDDTHQKQRDSNIPKRALPPRQIPQKNQNHLGGRVSS
ANLSLGVSFAGYGYFPSLYGLLNQYKNNITDQLESNVSPEVAKQPFLERFFYILCILCIL
FLVFCM


>TTHERM_00686060(gene)
ATGTAGCATTAATAGCATGATGAAGAAGAATAAAAAAGCAGTGCAAGTGATATTCATGCT
TTGTTAGAGAAATTCGAATGCACAGTTTGTTTAGAAGTTGCAAAAGAACCTGTTGTCACA
GAATGCGGTCATTTATTTTGGTAATATTATTTATCTAATACTATTGATTAAATATTTTAT
ATATTTATAAAATATAGCTGGCCATGCATTTATAAGGTAATTAAATGGAATAAATATAAA
GCATCATATTTGTATGGAAAGATAATAAAAATTTTAAATAAAAAGTGCATTAGATTAAAA
AATGTTTTATTTAAATGATTTGTAATTAATTTTTTGTATAATTTATAGTGGTTGAATTAA
AATAATGAGTATTTAGTATGTCCAAATTGCAAAAATGGAATTAAAAAAGAACTAATAAGA
CCTCTTTATGCTCGTAATGAAGATGATACCCACCAAAAATAGAGGTTAAATTTATTTAAA
AATCAGTTTAGAATAATATTTAATTTTAATATTCATAAAAAGAGATTCAAATATACCTAA
AAGAGCATTACCTCCTCGTTAAATCCCTTAAAAAAATTAAAATCACCTTGGAGGAGTAAA
CTTTATTCATAAATGAATATAAAATTCATTTTATTATTTAATTTATTGAAAAAGAGAGTC
TCTTCAGCAAATTTATCATTAGGAGTAAGCTTTGCAGGTTATGGATACTTCCCATCTTTG
TATGGCTTGTTAAATGTAAAAATTATACTTCTTGTATAAATTATTGATATTAACATTTTA
CTATTATAAAGCAATATAAAAATAACATTACAGATCAGTTGGAGTGTAAATTGTTTTAAT
ATTAAAATAATAAATTTATCATGTATAATTTAAAAATATAGCAAATGTTTCTCCGGAAGT
TGCAAAGCAACCGTTTTTAGAAAGATTCTTTTACATTTTGTGCATATTATGTATTTTATT
TTTAGTTTTTTGTATGTGA